LXL04_023239 | RubberDandelionOmics

Gene overview

LXL04_023239

Reference: OH-1004 Chr: Chr05 Coordinates: 28246659-28253944 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1588 bp · LXL04_023239|LXL04_023239|OH1004|cDNA

AGTGAAATTTCGACATTTCGAAGAGCTTTTGCGCATTACAGAGAGACAAGCAAAACCCTCGAAACTCCCTCTCATCATCTCGATTCCAATCCTCAAAACTACCCCCAACAAATCTTGTTTCGAATCCATTTGGGTACGATTTCGGTGAATATACCTTGTTGATCACTCCGAAAAGATACTAATGTCAGACAATGAGAAGATCGCCCTGGTTGATTCATCGACGAGCTCCCGGTCGGTGACGCAGACGGTGAACGGCTCCC...

CDS

Download CDS FASTA

1407 bp · LXL04_023239|LXL04_023239|OH1004|CDS

ATGTCAGACAATGAGAAGATCGCCCTGGTTGATTCATCGACGAGCTCCCGGTCGGTGACGCAGACGGTGAACGGCTCCCACCAGTTCGTAATTCAGGGGTATTCGTTAGCGAAGGGTATGGGAATCGGAAAACACATCGCCAGTGATAATTTCACGGTGGGAGGGTACCAATGGGCTGTATACTTCTACCCTGATGGGAAAAACCCTGAAGATAATTCGACTTATGTTTCGCTTTTCATTGCACTTACCAGTGAGGGTTC...

Protein

Download Protein FASTA

468 aa · LXL04_023239|LXL04_023239|OH1004|PROTEIN

MSDNEKIALVDSSTSSRSVTQTVNGSHQFVIQGYSLAKGMGIGKHIASDNFTVGGYQWAVYFYPDGKNPEDNSTYVSLFIALTSEGSDVRALFELTLVDQSGKEKHKVHSHFDRSLESGPYTLKYRGSMGYKRFYRRQLLETSDYLKDDCLKINCTVGVVVSATDCPRLHSIHVPDSDIGSNFGMLLTNMEGCDVIFKVGAEKFHAHKLVLAARSPVFHSQFYQQEGDHDEVVITDMEPKVFEAMIQFIYRDELTDELVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023239`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023239

Location Chr05:28246659-28253944 (-)

Description Similar to BPM6: BTB/POZ and MATH domain-containing protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43700`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g21010`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g03740`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g39760`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g06190`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023239 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031396 regulation of protein ubiquitination Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT2G39760

ath:AT3G03740

ath:AT3G43700

ath:AT5G21010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500

Rank 1 · LXL04_023239 · OH-1004

Nucleus0.469

Rank 2 · LXL04_023239 · OH-1004

Cell membrane0.119

Rank 3 · LXL04_023239 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_023239 · OH-1004

Lysosome / Vacuole0.049

Rank 5 · LXL04_023239 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22486.3MATH_227-157 aa

PF21355.4TRAF-mep_MATH48-153 aa

PF00651.38BTB186-301 aa

PF00561.27Abhydrolase_1326-415 aa

PF12146.16Hydrolase_4339-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023239	`PF22486.3`	MATH_2	27	157	3.2e-28	99.4
LXL04_023239	`PF21355.4`	TRAF-mep_MATH	48	153	5e-06	27.6
LXL04_023239	`PF00651.38`	BTB	186	301	8.1e-25	87.9
LXL04_023239	`PF00561.27`	Abhydrolase_1	326	415	1.1e-07	32.5
LXL04_023239	`PF12146.16`	Hydrolase_4	339	413	2.6e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A1L4W5`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 6	67.901%	Swiss-Prot	moderate database homology
`Q1EBV6`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 5	68.438%	Swiss-Prot	moderate database homology
`Q9SRV1`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 4	71.519%	Swiss-Prot	moderate database homology
`O22286`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 3	59.365%	Swiss-Prot	moderate database homology
`Q9M8J9`	Arabidopsis thaliana	BTB/POZ and MATH domain-containing protein 2	60.062%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card