LXL04_023186 | RubberDandelionOmics

Gene overview

LXL04_023186

Reference: OH-1004 Chr: Chr05 Coordinates: 25994359-25996266 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · LXL04_023186|LXL04_023186|OH1004|cDNA

ATGAAAACGGAGAAGGCGTTTTTGAAGCAACCCAAAGTGTTTATCTGCTCGAAGAAAAGTGGGAAATGTAAGAGGCCTGGAAAGGGTGGAAACAGATTCTTTAAGAGTGTCGGTCTTGGCTTCAAGACACCAAGAAAAGCCATCGAAGGAACTTACATTGAGAAGAAGTGTCCTTTCACCCGTGATGTTTCCATCAGAGGCCGTATTTTAGCTGGAACATGCCACTGTGCAAAGATGGTAAGGACCATTATTGTTCGAAG...

CDS

Download CDS FASTA

474 bp · LXL04_023186|LXL04_023186|OH1004|CDS

ATGAAAACGGAGAAGGCGTTTTTGAAGCAACCCAAAGTGTTTATCTGCTCGAAGAAAAGTGGGAAATGTAAGAGGCCTGGAAAGGGTGGAAACAGATTCTTTAAGAGTGTCGGTCTTGGCTTCAAGACACCAAGAAAAGCCATCGAAGGAACTTACATTGAGAAGAAGTGTCCTTTCACCCGTGATGTTTCCATCAGAGGCCGTATTTTAGCTGGAACATGCCACTGTGCAAAGATGGTAAGGACCATTATTGTTCGAAG...

Protein

Download Protein FASTA

157 aa · LXL04_023186|LXL04_023186|OH1004|PROTEIN

MKTEKAFLKQPKVFICSKKSGKCKRPGKGGNRFFKSVGLGFKTPRKAIEGTYIEKKCPFTRDVSIRGRILAGTCHCAKMVRTIIVRRDYFHYVKKYQRYEKRHSNTPAHISPCFRVKEGDRVTIGQCRPLSKTVRFNVLKVVPAGSSGGGKKAFTSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023186`
TK1151 ID	TkA06G389210
OH-1004 ID	LXL04_023186
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 98.113 / OH-1004 99.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023186

Location Chr05:25994359-25996266 (+)

Description Similar to RPS11: 40S ribosomal protein S11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30800`	Small ribosomal subunit protein uS17y.	No verified direct reference in this release
`At5g23740`	Small ribosomal subunit protein uS17x.	No verified direct reference in this release
`At3g48930`	Small ribosomal subunit protein uS17z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023186 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

GO:0019843 rRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G48930

ath:AT4G30800

ath:AT5G23740

gmx:547984

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.455

Rank 1 · LXL04_023186 · OH-1004

Plastid0.435

Rank 2 · LXL04_023186 · OH-1004

Nucleus0.109

Rank 3 · LXL04_023186 · OH-1004

Mitochondrion0.099

Rank 4 · LXL04_023186 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_023186 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16205.11Ribosomal_S17_N2-70 aa

PF00366.27Ribosomal_S1772-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023186	`PF16205.11`	Ribosomal_S17_N	2	70	1.4e-27	96.6
LXL04_023186	`PF00366.27`	Ribosomal_S17	72	140	7.9e-26	90.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65569`	Arabidopsis thaliana	Small ribosomal subunit protein uS17y	85.065%	Swiss-Prot	strong database homology
`P42733`	Arabidopsis thaliana	Small ribosomal subunit protein uS17x	81.818%	Swiss-Prot	strong database homology
`P16181`	Arabidopsis thaliana	Small ribosomal subunit protein uS17z	82.581%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card