RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_021243
Reference: OH-1004 Chr: Chr04 Coordinates: 125380895-125383943 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1917 bp · LXL04_021243|LXL04_021243|OH1004|cDNA

ATGATCACCGGCCATGACTTCTACACCGTCATGTCTGCCATGGTGCCTTTGTATGTCGCCATGATACTCGCCTACGGTAGTGTGCGGTGGTGGAAGATATTCACTCCCGATCAGTGCTCCGGCATCAACCGTTTCGTCGCCATTTTCGCCGTCCCTTTGCTGTCGTTTCATTTTATATCCATGAACAATCCTTACGCCATGAACTTCCGGTTCATCGCTGCCGACACTCTTCAGAAAATTATTATGTTGGTGGTGCTGGG...

CDS

Download CDS FASTA

1917 bp · LXL04_021243|LXL04_021243|OH1004|CDS

ATGATCACCGGCCATGACTTCTACACCGTCATGTCTGCCATGGTGCCTTTGTATGTCGCCATGATACTCGCCTACGGTAGTGTGCGGTGGTGGAAGATATTCACTCCCGATCAGTGCTCCGGCATCAACCGTTTCGTCGCCATTTTCGCCGTCCCTTTGCTGTCGTTTCATTTTATATCCATGAACAATCCTTACGCCATGAACTTCCGGTTCATCGCTGCCGACACTCTTCAGAAAATTATTATGTTGGTGGTGCTGGG...

Protein

Download Protein FASTA

638 aa · LXL04_021243|LXL04_021243|OH1004|PROTEIN

MITGHDFYTVMSAMVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFISMNNPYAMNFRFIAADTLQKIIMLVVLGLWANFTKNGSLEWMITIFSLSTLPNTLVMGIPLLIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLGLGGMTPRPSNLTGAEIYSLSSSRNPTPRGSNFNNSDFYSMMGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_021243
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_021243
LocationChr04:125380895-125383943 (+)
DescriptionSimilar to PIN3: Auxin efflux carrier component 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g70940 Acts as a component of the auxin efflux carrier.
Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023
Structures and mechanisms of the Arabidopsis auxin transporter PIN3.2022 · DOI: 10.1038/s41586-022-05142-w
At1g23080 Acts as a component of the auxin efflux carrier.
Efflux-dependent auxin gradients establish the apical-basal axis of Arabidopsis.2003 · DOI: 10.1038/nature02085
Differential auxin-transporting activities of PIN-FORMED proteins in Arabidopsis root hair cells.2010 · DOI: 10.1104/pp.110.156505
Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023
At2g01420 Acts as a component of the auxin efflux carrier.
Differential auxin-transporting activities of PIN-FORMED proteins in Arabidopsis root hair cells.2010 · DOI: 10.1104/pp.110.156505
Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023
Root System Depth in Arabidopsis Is Shaped by EXOCYST70A3 via the Dynamic Modulation of Auxin Transport.2019 · DOI: 10.1016/j.cell.2019.06.021

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0232300 May act as a component of the auxin efflux carrier. No verified direct reference in this release
Os02g0743400 Acts as a component of the auxin efflux carrier.
A PIN1 family gene, OsPIN1, involved in auxin-dependent adventitious root emergence and tillering in rice.2005 · DOI: 10.1093/pcp/pci183
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009416 response to light stimulus Biological Process
GO:0009606 tropism Biological Process
GO:0009630 gravitropism Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0009942 longitudinal axis specification Biological Process
GO:0009958 positive gravitropism Biological Process
GO:0010015 root morphogenesis Biological Process
GO:0010315 auxin export across the plasma membrane Biological Process
GO:0048364 root development Biological Process
GO:0048766 root hair initiation Biological Process
GO:0048767 root hair elongation Biological Process
KEGG gene cross-reference
ath:AT1G23080
ath:AT1G70940
ath:AT2G01420
dosa:Os02g0743400
dosa:Os06g0232300
osa:4330700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.771
Rank 1 · LXL04_021243 · OH-1004
Endoplasmic reticulum0.092
Rank 2 · LXL04_021243 · OH-1004
Cytoplasm0.087
Rank 3 · LXL04_021243 · OH-1004
Lysosome / Vacuole0.068
Rank 4 · LXL04_021243 · OH-1004
Golgi apparatus0.049
Rank 5 · LXL04_021243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03547.24Mem_trans10-633 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_021243PF03547.24Mem_trans106331.1e-129432.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9S7Z8Arabidopsis thalianaAuxin efflux carrier component 375.610%Swiss-Protstrong database homology
Q940Y5Arabidopsis thalianaAuxin efflux carrier component 776.087%Swiss-Protstrong database homology
Q8RWZ6Arabidopsis thalianaAuxin efflux carrier component 475.000%Swiss-Protstrong database homology
Q67UL3Oryza sativa subsp. japonicaProbable auxin efflux carrier component 1c64.142%Swiss-Protstrong database homology
Q5SMQ9Oryza sativa subsp. japonicaAuxin efflux carrier component 1a63.846%Swiss-Protstrong database homology

JBrowse

View in Genome Browser