LXL04_021220 | RubberDandelionOmics

Gene overview

LXL04_021220

Reference: OH-1004 Chr: Chr04 Coordinates: 124821758-124823078 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_021220|LXL04_021220|OH1004|cDNA

ATGGAAGGCGTGCACGGATTATTGAAGTTGCGAGTGAAAAGAGGGATCAATCTCGCTGTTCGTGACGCCAAAAGCAGCGATCCTTATCTCGTTGCGACCTTGGATGGCCAGAAAACAAAGACTAGGGTTATCAAGGGGAACTGCAATCCTGTGTGGAATGATGAATTGACTCTCACAATGAGAGACCCCATCAATCCAGTTAGTATTGCTGTGTACGACAGGGACAGGTTTAGCAATGACGATAGTATGGGGGTGGCAGA...

CDS

Download CDS FASTA

507 bp · LXL04_021220|LXL04_021220|OH1004|CDS

ATGGAAGGCGTGCACGGATTATTGAAGTTGCGAGTGAAAAGAGGGATCAATCTCGCTGTTCGTGACGCCAAAAGCAGCGATCCTTATCTCGTTGCGACCTTGGATGGCCAGAAAACAAAGACTAGGGTTATCAAGGGGAACTGCAATCCTGTGTGGAATGATGAATTGACTCTCACAATGAGAGACCCCATCAATCCAGTTAGTATTGCTGTGTACGACAGGGACAGGTTTAGCAATGACGATAGTATGGGGGTGGCAGA...

Protein

Download Protein FASTA

168 aa · LXL04_021220|LXL04_021220|OH1004|PROTEIN

MEGVHGLLKLRVKRGINLAVRDAKSSDPYLVATLDGQKTKTRVIKGNCNPVWNDELTLTMRDPINPVSIAVYDRDRFSNDDSMGVADIDVKPYIECLRKGLDLKKIPNGTTLDRIQPKKNNYLSDESCIVCEDGKIVQDMVVRLREVECGEVVLQIELIPVAGRKLHV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021220`
TK1151 ID	TkA05G367690
OH-1004 ID	LXL04_021220
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021220

Location Chr04:124821758-124823078 (-)

Description Similar to CAR10: Protein C2-DOMAIN ABA-RELATED 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01540`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release
`At1g70790`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973 LOWER TEMPERATURE 1 Enhances ABA Responses and Plant Drought Tolerance by Modulating the Stability and Localization of C2-Domain ABA-Related Proteins in Arabidopsis.2019 · DOI: 10.1016/j.molp.2019.05.002
`At1g70810`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release
`At1g23140`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release
`At5g37740`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021220 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005096 GTPase activator activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005543 phospholipid binding Molecular Function

KEGG gene cross-reference

ath:AT1G23140

ath:AT1G70790

ath:AT1G70810

ath:AT2G01540

ath:AT5G37740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423

Rank 1 · LXL04_021220 · OH-1004

Cell membrane0.399

Rank 2 · LXL04_021220 · OH-1004

Nucleus0.287

Rank 3 · LXL04_021220 · OH-1004

Endoplasmic reticulum0.073

Rank 4 · LXL04_021220 · OH-1004

Golgi apparatus0.054

Rank 5 · LXL04_021220 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C27-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021220	`PF00168.37`	C2	7	92	1.4e-20	74.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVF1`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 10	52.532%	Swiss-Prot	strong database homology
`Q9S7J9`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 9	53.125%	Swiss-Prot	strong database homology
`Q9SSL1`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 7	52.121%	Swiss-Prot	strong database homology
`O49303`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 8	50.307%	Swiss-Prot	strong database homology
`Q9FHP6`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 1	50.602%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card