LXL04_020080 | RubberDandelionOmics

Gene overview

LXL04_020080

Reference: OH-1004 Chr: Chr04 Coordinates: 51207702-51209837 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_020080|LXL04_020080|OH1004|cDNA

ATGGAAATAATGAGCCAATACCGGTGGGTTGCAAGCTCTTGTGCTGTGGCTATGGCCATGGCGGTGCCGTGGAAAGTGTTGGAGTGGATATGGTTCAAACCAAAAAGGCTTGAAAAGTACCTAAGGCAGCAAGGTCTCATCGGCACCTCCTACAAGCCACCCTTTGGAGATACAAAAGAGATCATGCACACAACAAAGCTAGAGCCCATGAATCTTTCAGATGATATCATGCCTAGAGTCATGCCCTTTGTACATAGGGC...

CDS

Download CDS FASTA

1575 bp · LXL04_020080|LXL04_020080|OH1004|CDS

ATGGAAATAATGAGCCAATACCGGTGGGTTGCAAGCTCTTGTGCTGTGGCTATGGCCATGGCGGTGCCGTGGAAAGTGTTGGAGTGGATATGGTTCAAACCAAAAAGGCTTGAAAAGTACCTAAGGCAGCAAGGTCTCATCGGCACCTCCTACAAGCCACCCTTTGGAGATACAAAAGAGATCATGCACACAACAAAGCTAGAGCCCATGAATCTTTCAGATGATATCATGCCTAGAGTCATGCCCTTTGTACATAGGGC...

Protein

Download Protein FASTA

524 aa · LXL04_020080|LXL04_020080|OH1004|PROTEIN

MEIMSQYRWVASSCAVAMAMAVPWKVLEWIWFKPKRLEKYLRQQGLIGTSYKPPFGDTKEIMHTTKLEPMNLSDDIMPRVMPFVHRAIQTYGKIFFAWFGPVPTLHISDPEVVRDVLSRMNEFQKPRKNNPYIKILSTGVIDYEGDKWSKHRKIINPTFHAEKLKLMAPAMCLSCCEMIKRWEMLFSNEQSLELDVFPHLQKLSGDVISRTAFGSSYEEGVRIFDLQYEIGSILMHVMQSLYIPGSRFFPNARNKRMEEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020080`
TK1151 ID	TkA05G133420
OH-1004 ID	LXL04_020080
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.500
Protein coverage (%)	TK1151 100.000 / OH-1004 96.756 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020080

Location Chr04:51207702-51209837 (-)

Description Similar to Cytochrome P450 CYP72A219

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14690`	Cytochrome P450 72A15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020080 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016134 saponin metabolic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ag:ABC59075

ath:AT3G14690

mtr:25486186

mtr:25486777

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.863

Rank 1 · LXL04_020080 · OH-1004

Cytoplasm0.056

Rank 2 · LXL04_020080 · OH-1004

Mitochondrion0.046

Rank 3 · LXL04_020080 · OH-1004

Cell membrane0.041

Rank 4 · LXL04_020080 · OH-1004

Nucleus0.028

Rank 5 · LXL04_020080 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45085-493 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020080	`PF00067.28`	p450	85	493	7.8e-85	286.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUC5`	Arabidopsis thaliana	Cytochrome P450 72A15	50.973%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card