LXL04_019594 | RubberDandelionOmics

Gene overview

LXL04_019594

Reference: OH-1004 Chr: Chr04 Coordinates: 34781991-34787600 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2859 bp · LXL04_019594|LXL04_019594|OH1004|cDNA

ATGAAGAAGAAACCTCATCACCATAACAACGCTGTTTACATCGGCATCGGTATCTTTCAAGGTGTAATACTCTGCCACCGTCGCCGCTTCCACCTCCACCATCTCCTCCCTTTCATCTCCGCCGTCACTGGTTGTATTTTATTCCTTTTCGCTGTTTTATCATTCCTGTCGCCACCAATCAACCACGACCATTACCATCATAGCGGAAGCGAGTTTGATCAGGACATCGAGGTGCGGTCAAATGCCGGAAAGCCGACAGC...

CDS

Download CDS FASTA

2859 bp · LXL04_019594|LXL04_019594|OH1004|CDS

ATGAAGAAGAAACCTCATCACCATAACAACGCTGTTTACATCGGCATCGGTATCTTTCAAGGTGTAATACTCTGCCACCGTCGCCGCTTCCACCTCCACCATCTCCTCCCTTTCATCTCCGCCGTCACTGGTTGTATTTTATTCCTTTTCGCTGTTTTATCATTCCTGTCGCCACCAATCAACCACGACCATTACCATCATAGCGGAAGCGAGTTTGATCAGGACATCGAGGTGCGGTCAAATGCCGGAAAGCCGACAGC...

Protein

Download Protein FASTA

952 aa · LXL04_019594|LXL04_019594|OH1004|PROTEIN

MKKKPHHHNNAVYIGIGIFQGVILCHRRRFHLHHLLPFISAVTGCILFLFAVLSFLSPPINHDHYHHSGSEFDQDIEVRSNAGKPTAFLVPTSRTEGSVRRNLWRSSQSQLYYGCSEKNQHFLEAKAKTNPHRFLLIATSGGLNQQRTGITDAVVAAYILNATLVVPKLDQKSYWKDERIDIETVTEVDSVLMGSILCSNFSEIFDVDWFISYLSKEVKIVKELPAINGRVVHPYRTRVPRKCNQGCYQSRMVPLLNKKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019594`
TK1151 ID	TkA05G067300
OH-1004 ID	LXL04_019594
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.200
Protein coverage (%)	TK1151 92.791 / OH-1004 62.920 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019594

Location Chr04:34781991-34787600 (+)

Description Similar to OFUT6: O-fucosyltransferase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20550`	O-fucosyltransferase 6.	No verified direct reference in this release
`At1g76270`	O-fucosyltransferase 16.	No verified direct reference in this release
`At4g38390`	Protein ROOT HAIR SPECIFIC 17.	No verified direct reference in this release
`At4g16650`	O-fucosyltransferase 29.	No verified direct reference in this release
`At1g22460`	O-fucosyltransferase 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019594 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20550

ath:AT1G22460

ath:AT1G76270

ath:AT4G16650

ath:AT4G38390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.422

Rank 1 · LXL04_019594 · OH-1004

Endoplasmic reticulum0.231

Rank 2 · LXL04_019594 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_019594 · OH-1004

Lysosome / Vacuole0.081

Rank 4 · LXL04_019594 · OH-1004

Extracellular0.064

Rank 5 · LXL04_019594 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250.16O-FucT134-468 aa

PF26130.1PB1-like556-622 aa

PF10551.16MULE761-839 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019594	`PF10250.16`	O-FucT	134	468	1.7e-97	327.9
LXL04_019594	`PF26130.1`	PB1-like	556	622	3e-08	34.6
LXL04_019594	`PF10551.16`	MULE	761	839	2.8e-12	47.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HSU3`	Arabidopsis thaliana	O-fucosyltransferase 6	60.449%	Swiss-Prot	moderate database homology
`Q949U4`	Arabidopsis thaliana	O-fucosyltransferase 16	62.407%	Swiss-Prot	moderate database homology
`Q9SVE6`	Arabidopsis thaliana	Protein ROOT HAIR SPECIFIC 17	61.220%	Swiss-Prot	moderate database homology
`Q8LPF8`	Arabidopsis thaliana	O-fucosyltransferase 29	52.590%	Swiss-Prot	moderate database homology
`B7ZWR7`	Arabidopsis thaliana	O-fucosyltransferase 7	39.270%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card