LXL04_019405 | RubberDandelionOmics

Gene overview

LXL04_019405

Reference: OH-1004 Chr: Chr04 Coordinates: 30587704-30588711 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · LXL04_019405|LXL04_019405|OH1004|cDNA

ATGGGTGTGAATCAAGTTTGGGGATTGTTGGTGGTGTTGCTTTTCCTCAATGGATGTTTGATTAAGATTTCTGGATCCAATCAGTCAAGGAAGGCTAGTATTCCTTCCAGACCGAATGTTGTGAAAATTGGTTCGATTTTGACATTCAATTCGATAGTGGGAAAAGTTGGGAAAATTGCATTAGAGGCTGCGGTAGAAGATGTGAATTCTGATCCAGCGGTTCTTAATGGAACCAAGCTGGAACTCACCATTCATGACTC...

CDS

Download CDS FASTA

456 bp · LXL04_019405|LXL04_019405|OH1004|CDS

ATGGGTGTGAATCAAGTTTGGGGATTGTTGGTGGTGTTGCTTTTCCTCAATGGATGTTTGATTAAGATTTCTGGATCCAATCAGTCAAGGAAGGCTAGTATTCCTTCCAGACCGAATGTTGTGAAAATTGGTTCGATTTTGACATTCAATTCGATAGTGGGAAAAGTTGGGAAAATTGCATTAGAGGCTGCGGTAGAAGATGTGAATTCTGATCCAGCGGTTCTTAATGGAACCAAGCTGGAACTCACCATTCATGACTC...

Protein

Download Protein FASTA

151 aa · LXL04_019405|LXL04_019405|OH1004|PROTEIN

MGVNQVWGLLVVLLFLNGCLIKISGSNQSRKASIPSRPNVVKIGSILTFNSIVGKVGKIALEAAVEDVNSDPAVLNGTKLELTIHDSNSSGFVSILEALQLMESESVALIGVGENPFLKSKLISNYLMDRVKSLSESDISTLCQGITKSRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019405`
TK1151 ID	TkA05G049460
OH-1004 ID	LXL04_019405
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019405

Location Chr04:30587704-30588711 (+)

Description Similar to GLR3.6: Glutamate receptor 3.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51480`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478
`At1g42540`	Glutamate-gated receptor that probably acts as a non-selective cation channel, at least in roots and hypocotyls (Probable).	Calcium entry mediated by GLR3.3, an Arabidopsis glutamate receptor with a broad agonist profile.2006 · DOI: 10.1104/pp.106.088989 Glutamate receptor subtypes evidenced by differences in desensitization and dependence on the GLR3.3 and GLR3.4 genes.2008 · DOI: 10.1104/pp.107.108134 Glutamate receptor-like channel3.3 is involved in mediating glutathione-triggered cytosolic calcium transients, transcriptional changes, and innate immunity responses in Arabidopsis.2013 · DOI: 10.1104/pp.113.217208 Involvement of the glutamate receptor AtGLR3.3 in plant defense signaling and resistance to Hyaloperonospora arabidopsidis.2013 · DOI: 10.1111/tpj.12311 GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478 Real-time, in vivo intracellular recordings of caterpillar-induced depolarization waves in sieve elements using aphid electrodes.2014 · DOI: 10.1111/nph.12807
`At2g17260`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	De-regulated expression of the plant glutamate receptor homolog AtGLR3.1 impairs long-term Ca2+-programmed stomatal closure.2009 · DOI: 10.1111/j.1365-313x.2009.03789.x
`At4g35290`	Glutamate-gated receptor that probably acts as a non-selective cation channel (Probable).	Overexpression of the AtGluR2 gene encoding an Arabidopsis homolog of mammalian glutamate receptors impairs calcium utilization and sensitivity to ionic stress in transgenic plants.2001 · DOI: 10.1093/pcp/pce008 Interacting glutamate receptor-like proteins in Phloem regulate lateral root initiation in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110668
`At1g05200`	Glutamate-gated receptor that probably acts as a non-selective cation channel, at least in hypocotyls (Probable).	AtGLR3.4, a glutamate receptor channel-like gene is sensitive to touch and cold.2005 · DOI: 10.1007/s00425-005-1551-3 Glutamate receptor subtypes evidenced by differences in desensitization and dependence on the GLR3.3 and GLR3.4 genes.2008 · DOI: 10.1104/pp.107.108134 Dual localization of plant glutamate receptor AtGLR3.4 to plastids and plasmamembrane.2011 · DOI: 10.1016/j.bbabio.2010.11.008 Interacting glutamate receptor-like proteins in Phloem regulate lateral root initiation in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110668 Glutamate Receptor Homolog3.4 is Involved in Regulation of Seed Germination Under Salt Stress in Arabidopsis.2018 · DOI: 10.1093/pcp/pcy034

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019405 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006883 intracellular sodium ion homeostasis Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009630 gravitropism Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0010118 stomatal movement Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G05200

ath:AT1G42540

ath:AT2G17260

ath:AT3G51480

ath:AT4G35290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.354

Rank 1 · LXL04_019405 · OH-1004

Cell membrane0.231

Rank 2 · LXL04_019405 · OH-1004

Endoplasmic reticulum0.136

Rank 3 · LXL04_019405 · OH-1004

Cytoplasm0.131

Rank 4 · LXL04_019405 · OH-1004

Lysosome / Vacuole0.110

Rank 5 · LXL04_019405 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01094.35ANF_receptor59-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019405	`PF01094.35`	ANF_receptor	59	114	9.7e-10	38.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W41`	Arabidopsis thaliana	Glutamate receptor 3.6	57.692%	Swiss-Prot	moderate database homology
`Q9C8E7`	Arabidopsis thaliana	Glutamate receptor 3.3	43.119%	Swiss-Prot	moderate database homology
`Q7XJL2`	Arabidopsis thaliana	Glutamate receptor 3.1	51.316%	Swiss-Prot	moderate database homology
`Q93YT1`	Arabidopsis thaliana	Glutamate receptor 3.2	48.000%	Swiss-Prot	weak database homology
`Q8GXJ4`	Arabidopsis thaliana	Glutamate receptor 3.4	48.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card