LXL04_019195 | RubberDandelionOmics

Gene overview

LXL04_019195

Reference: OH-1004 Chr: Chr04 Coordinates: 26299040-26299644 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · LXL04_019195|LXL04_019195|OH1004|cDNA

ATGGGGATCCAGGGACTTTTGCCTCTAATGAAATCGGTTATGGTTCTGATCCACATAAAGGATCTCGAAGATTGTTCTGTTGACGTAGATACTTACTCTTGGCTCCATAAGGGAGCTCTTTCTTGCAGCATGGAGCTCTACAAATCCCAACCTACTTCCAAGTACACATCTTTCTTGTGTTCCCAATACATTAGGAAACAAATAACTCCATCAGGTTCATCCTTCACGACGTCTTCCTCTATTGCTTCAAGAATCGCTAA...

CDS

Download CDS FASTA

480 bp · LXL04_019195|LXL04_019195|OH1004|CDS

ATGGGGATCCAGGGACTTTTGCCTCTAATGAAATCGGTTATGGTTCTGATCCACATAAAGGATCTCGAAGATTGTTCTGTTGACGTAGATACTTACTCTTGGCTCCATAAGGGAGCTCTTTCTTGCAGCATGGAGCTCTACAAATCCCAACCTACTTCCAAGTACACATCTTTCTTGTGTTCCCAATACATTAGGAAACAAATAACTCCATCAGGTTCATCCTTCACGACGTCTTCCTCTATTGCTTCAAGAATCGCTAA...

Protein

Download Protein FASTA

159 aa · LXL04_019195|LXL04_019195|OH1004|PROTEIN

MGIQGLLPLMKSVMVLIHIKDLEDCSVDVDTYSWLHKGALSCSMELYKSQPTSKYTSFLCSQYIRKQITPSGSSFTTSSSIASRIANLFLAGISSFYYASIKASPFHSDSNSLDSFTINSVTEIQCLPLPSYAVTPKTRLQQLFFFSVSSFPIMGNGNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019195`
TK1151 ID	TkA05G028890
OH-1004 ID	LXL04_019195
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 71.717 / OH-1004 89.308 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019195

Location Chr04:26299040-26299644 (+)

Description Similar to EXO1: Exonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29630`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0777300`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019195 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0002376 immune system process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0090656 t-circle formation Biological Process

GO:0110025 DNA strand resection involved in replication fork processing Biological Process

GO:1905634 regulation of protein localization to chromatin Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G29630

ddi:DDB_G0291570

dosa:Os01g0777300

hsa:9156

xla:399140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.437

Rank 1 · LXL04_019195 · OH-1004

Cytoplasm0.376

Rank 2 · LXL04_019195 · OH-1004

Mitochondrion0.123

Rank 3 · LXL04_019195 · OH-1004

Endoplasmic reticulum0.085

Rank 4 · LXL04_019195 · OH-1004

Cell membrane0.061

Rank 5 · LXL04_019195 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00752.24XPG_N1-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019195	`PF00752.24`	XPG_N	1	65	5.4e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L6Z7`	Arabidopsis thaliana	Exonuclease 1	70.690%	Swiss-Prot	weak database homology
`Q60GC1`	Oryza sativa subsp. japonica	Exonuclease 1	55.172%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card