LXL04_019125 | RubberDandelionOmics

Gene overview

LXL04_019125

Reference: OH-1004 Chr: Chr04 Coordinates: 24122324-24126745 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3042 bp · LXL04_019125|LXL04_019125|OH1004|cDNA

ATGAAGCCAAATCGCAAGCTCAAGAAACCCCCAACTTCTTGTTCTAAGTTCGATTTGGAAGAGATTATCGGGTTGACGGTGAGGAACGACAACGGATTGGCTTCTAGCACTTCCGATTCCAAGTTTGTATATATAGCAGGATGTGTTGTAGTGCTTTACGACGTCGATTCAGGAACTCAATCGCACCTTATGGAGTCTAATCGTTCGCCCAAGCCTTTCAGCTGTGTTGCCGTCTCTCAAGATGGAAGCTATATTGCAGC...

CDS

Download CDS FASTA

3042 bp · LXL04_019125|LXL04_019125|OH1004|CDS

ATGAAGCCAAATCGCAAGCTCAAGAAACCCCCAACTTCTTGTTCTAAGTTCGATTTGGAAGAGATTATCGGGTTGACGGTGAGGAACGACAACGGATTGGCTTCTAGCACTTCCGATTCCAAGTTTGTATATATAGCAGGATGTGTTGTAGTGCTTTACGACGTCGATTCAGGAACTCAATCGCACCTTATGGAGTCTAATCGTTCGCCCAAGCCTTTCAGCTGTGTTGCCGTCTCTCAAGATGGAAGCTATATTGCAGC...

Protein

Download Protein FASTA

1013 aa · LXL04_019125|LXL04_019125|OH1004|PROTEIN

MKPNRKLKKPPTSCSKFDLEEIIGLTVRNDNGLASSTSDSKFVYIAGCVVVLYDVDSGTQSHLMESNRSPKPFSCVAVSQDGSYIAAGESGQQPSIIVWSSATMASIPELKGHRYGVACMAFSPDGKHLVSVGTPQDGYLCFWDWRSGTLVKKMKACSSFCAVSSVTFSADANFILTAGKRHLKIWTVGLPTKSQAKTKTKTKTISLTMHGKAVNLGQLKGCTFVAVTSPFKTNGNVADGKGSEPVIVYALTDSGVLCLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019125`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019125`
Location	Chr04:24122324-24126745 (+)
Description	Similar to Mapkbp1: Mitogen-activated protein kinase-binding protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019125` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0007052 mitotic spindle organization Biological Process GO:0007099 centriole replication Biological Process GO:0032717 negative regulation of interleukin-8 production Biological Process GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process GO:0046330 positive regulation of JNK cascade Biological Process GO:0046605 regulation of centrosome cycle Biological Process GO:0097150 neuronal stem cell population maintenance Biological Process GO:1900425 negative regulation of defense response to bacterium Biological Process GO:0000922 spindle pole Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component
KEGG gene cross-reference	hsa:23005 hsa:284403 mmu:26390 ssc:100144885 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.758

Rank 1 · LXL04_019125 · OH-1004

Cytoplasm0.227

Rank 2 · LXL04_019125 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_019125 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_019125 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_019125 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24780.2WD40_MABP1-WDR62_1st32-365 aa

PF23414.2Beta-prop_EML_232-206 aa

PF23381.2Beta-prop_IFT122_1st36-133 aa

PF30552.1CFAP251_N37-187 aa

PF24814.2WD40_Prp1947-204 aa

PF25175.2Beta-prop_WDR548-188 aa

PF25173.2Beta-prop_WDR3_1st49-210 aa

PF25174.2Beta-prop_THOC349-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019125	`PF24780.2`	WD40_MABP1-WDR62_1st	32	365	1.8e-63	215.5
LXL04_019125	`PF23414.2`	Beta-prop_EML_2	32	206	1.7e-33	116.8
LXL04_019125	`PF23381.2`	Beta-prop_IFT122_1st	36	133	1.3e-39	136.9
LXL04_019125	`PF30552.1`	CFAP251_N	37	187	8.6e-22	78.5
LXL04_019125	`PF24814.2`	WD40_Prp19	47	204	3e-37	128.9
LXL04_019125	`PF25175.2`	Beta-prop_WDR5	48	188	2e-39	136.4
LXL04_019125	`PF25173.2`	Beta-prop_WDR3_1st	49	210	2.4e-49	168.2
LXL04_019125	`PF25174.2`	Beta-prop_THOC3	49	209	2.1e-38	132.6
LXL04_019125	`PF24817.2`	WD40_WDHD1_1st	49	163	6.9e-32	111.5
LXL04_019125	`PF24807.2`	WD40_CDC20-Fz	50	189	1.3e-27	97.6
LXL04_019125	`PF24796.2`	WDR55	50	190	1.2e-21	77.8
LXL04_019125	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	51	186	9.3e-20	71.9
LXL04_019125	`PF25460.2`	Beta-prop_Aladin	67	208	9.2e-09	35.6
LXL04_019125	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	68	186	3e-20	73.5
LXL04_019125	`PF23409.2`	Beta-prop_EML	74	199	1.1e-28	101.3
LXL04_019125	`PF25172.2`	Beta-prop_WDR3_2nd	75	208	3.7e-25	89.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card