LXL04_018263 | RubberDandelionOmics

Gene overview

LXL04_018263

Reference: OH-1004 Chr: Chr04 Coordinates: 10036933-10038828 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · LXL04_018263|LXL04_018263|OH1004|cDNA

ATGTCGTTCAGTCGTTATGCCCTAATCGAAGATTCCATAGTTCCCTATGTCGGTCGCGCTGCCTCTCTGCTAAACTTCACACGCCATACCCATATGTCGACCACCGCTAACGGTTCCGCCGCCGAAAGGCGTACAGCCACCAGCAATGGCCGCAGTCCGGTGGACAAAGAAGTCGACTTCGCCAACTACTTCTGCACATACGCTTTTCTCTTCCACCAAAAAGAGATGCTCTCCGATCGAGTTCGAATGGACGCTTACTA...

CDS

Download CDS FASTA

1236 bp · LXL04_018263|LXL04_018263|OH1004|CDS

ATGTCGTTCAGTCGTTATGCCCTAATCGAAGATTCCATAGTTCCCTATGTCGGTCGCGCTGCCTCTCTGCTAAACTTCACACGCCATACCCATATGTCGACCACCGCTAACGGTTCCGCCGCCGAAAGGCGTACAGCCACCAGCAATGGCCGCAGTCCGGTGGACAAAGAAGTCGACTTCGCCAACTACTTCTGCACATACGCTTTTCTCTTCCACCAAAAAGAGATGCTCTCCGATCGAGTTCGAATGGACGCTTACTA...

Protein

Download Protein FASTA

411 aa · LXL04_018263|LXL04_018263|OH1004|PROTEIN

MSFSRYALIEDSIVPYVGRAASLLNFTRHTHMSTTANGSAAERRTATSNGRSPVDKEVDFANYFCTYAFLFHQKEMLSDRVRMDAYYNSVFQNKHHFVGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMAVHAGELVKSNNLQDVIEVIEGSIEDITLPEKVDVIISEWMGYFLLRESMFDSVIYARDRWLKPNGVMYPSHARMYLAPIRSGLSDHKMRDYEGAMDDWHGFLKETEACYGVNMNVLTKPFSEEQKKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018263`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018263

Location Chr04:10036933-10038828 (-)

Description Similar to PRMT10: Protein arginine N-methyltransferase PRMT10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04870`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.2011 · DOI: 10.1016/j.jmb.2011.09.040

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0142800`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	No verified direct reference in this release
`UniProt: A2Y953`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	No verified direct reference in this release
`UniProt: A2XYY8`	Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA).	No verified direct reference in this release
`Os04g0677066`	Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018263 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0019919 peptidyl-arginine methylation, to asymmetrical-dimethyl arginine Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0016274 protein-arginine N-methyltransferase activity Molecular Function

GO:0035241 protein-arginine omega-N monomethyltransferase activity Molecular Function

GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity Molecular Function

GO:0042054 histone methyltransferase activity Molecular Function

GO:0044020 histone H4R3 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04870

dosa:Os06g0142800

osa:9268644

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · LXL04_018263 · OH-1004

Nucleus0.450

Rank 2 · LXL04_018263 · OH-1004

Mitochondrion0.090

Rank 3 · LXL04_018263 · OH-1004

Cell membrane0.043

Rank 4 · LXL04_018263 · OH-1004

Endoplasmic reticulum0.041

Rank 5 · LXL04_018263 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05175.21MTS98-170 aa

PF06325.20PrmA99-171 aa

PF13847.13Methyltransf_3199-206 aa

PF13649.13Methyltransf_25102-198 aa

PF08241.19Methyltransf_11103-200 aa

PF22528.2PRMT_C205-394 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018263	`PF05175.21`	MTS	98	170	4e-07	30.5
LXL04_018263	`PF06325.20`	PrmA	99	171	1.5e-12	48.4
LXL04_018263	`PF13847.13`	Methyltransf_31	99	206	1e-07	32.6
LXL04_018263	`PF13649.13`	Methyltransf_25	102	198	2.9e-09	38.2
LXL04_018263	`PF08241.19`	Methyltransf_11	103	200	7.9e-09	36.8
LXL04_018263	`PF22528.2`	PRMT_C	205	394	9.6e-23	81.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAT5`	Arabidopsis thaliana	Protein arginine N-methyltransferase PRMT10	66.944%	Swiss-Prot	strong database homology
`Q9SNQ2`	Oryza sativa subsp. japonica	Protein arginine N-methyltransferase PRMT10	65.084%	Swiss-Prot	strong database homology
`A2Y953`	Oryza sativa subsp. indica	Protein arginine N-methyltransferase PRMT10	65.084%	Swiss-Prot	strong database homology
`A2XYY8`	Oryza sativa subsp. indica	Probable protein arginine N-methyltransferase 6.1	36.390%	Swiss-Prot	moderate database homology
`Q7XKC0`	Oryza sativa subsp. japonica	Probable protein arginine N-methyltransferase 6.1	36.390%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card