LXL04_018191 | RubberDandelionOmics

Gene overview

LXL04_018191

Reference: OH-1004 Chr: Chr04 Coordinates: 8412004-8414087 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2007 bp · LXL04_018191|LXL04_018191|OH1004|cDNA

ATGGGAAAATCAAGAAAAAGCAAGAAAGTAGGATCAAATAACGCTAATCCGAATCAAAGCAAACTTGATGATGATAATCCCACAAAGATCTACGATAAAGACACTACCATTTTCATTTCGATGGCACAAGAACTTAAGGATGAAGGAAACAAGTTGTTCCAAAATAAAGATTACGAAGGAGCTACATTAAAGTACCAAAAAGCCCTCAAATTACTTCCAGGAAACCATTTAGATGTTTCTTATCTTCATAGCAACATTGC...

CDS

Download CDS FASTA

2007 bp · LXL04_018191|LXL04_018191|OH1004|CDS

ATGGGAAAATCAAGAAAAAGCAAGAAAGTAGGATCAAATAACGCTAATCCGAATCAAAGCAAACTTGATGATGATAATCCCACAAAGATCTACGATAAAGACACTACCATTTTCATTTCGATGGCACAAGAACTTAAGGATGAAGGAAACAAGTTGTTCCAAAATAAAGATTACGAAGGAGCTACATTAAAGTACCAAAAAGCCCTCAAATTACTTCCAGGAAACCATTTAGATGTTTCTTATCTTCATAGCAACATTGC...

Protein

Download Protein FASTA

668 aa · LXL04_018191|LXL04_018191|OH1004|PROTEIN

MGKSRKSKKVGSNNANPNQSKLDDDNPTKIYDKDTTIFISMAQELKDEGNKLFQNKDYEGATLKYQKALKLLPGNHLDVSYLHSNIAACYMQMGITDFPRAIHECNLALEITPKYTKALLKRARCYEALNRLDLALRDVNMVLDLEPNNLMAMEIIDRVKARMKDNLILEKKDHKNEQDIDSIKILEPLKEKVHKKKKKSPKLDHRIDEKKDFERDDKKMEDKIVVEEKINTISKEEPKRVVKLVYGEDIRWAKIPFDCD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018191`
TK1151 ID	TkA08G021150
OH-1004 ID	LXL04_018191
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018191

Location Chr04:8412004-8414087 (+)

Description Similar to PHOX1: Protein PHOX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25290`	Carboxylate clamp type tetratricopeptide repeat protein that may act as a potential Hsp90/Hsp70 co-chaperone.	Myosin-driven transport network in plants.2017 · DOI: 10.1073/pnas.1620577114
`At4g32070`	Carboxylate clamp-type tetratricopeptide repeat protein that may act as a potential Hsp90/Hsp70 co-chaperone.	No verified direct reference in this release
`At5g20360`	Carboxylate clamp type tetratricopeptide repeat protein that may act as a potential Hsp90/Hsp70 co-chaperone.	No verified direct reference in this release
`At1g62390`	Required for plastid separation and partitioning during cell division.	CLUMPED CHLOROPLASTS 1 is required for plastid separation in Arabidopsis.2011 · DOI: 10.1073/pnas.1106706108

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018191 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0080115 myosin XI tail binding Molecular Function

KEGG gene cross-reference

ath:AT1G62390

ath:AT2G25290

ath:AT4G32070

ath:AT5G20360

zma:103641203

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.547

Rank 1 · LXL04_018191 · OH-1004

Nucleus0.372

Rank 2 · LXL04_018191 · OH-1004

Cell membrane0.093

Rank 3 · LXL04_018191 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_018191 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_018191 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00564.31PB1241-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018191	`PF00564.31`	PB1	241	318	8.3e-13	48.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IRM4`	Arabidopsis thaliana	Protein PHOX1	48.966%	Swiss-Prot	moderate database homology
`F4JTI1`	Arabidopsis thaliana	Protein PHOX4	47.233%	Swiss-Prot	moderate database homology
`F4K487`	Arabidopsis thaliana	Protein PHOX3	39.691%	Swiss-Prot	moderate database homology
`O48802`	Arabidopsis thaliana	Protein CLMP1	37.021%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card