LXL04_018111 | RubberDandelionOmics

Gene overview

LXL04_018111

Reference: OH-1004 Chr: Chr04 Coordinates: 6814065-6816637 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1590 bp · LXL04_018111|LXL04_018111|OH1004|cDNA

ATGGATGTATATGAATCAAATCAAGCTTTAGAGACCCGAAAGAACAATGGAAGAATTCATCGGGAAATCAGTTCCAGTTCGAGGTACAAATCACCTACACCACGGCGTTTTCCATCCCCAAATGCAAGAACAACAGTTACAAGTACAAGTACAAGTACAACGTCGGCGCCGATATCAAAGAGAGCTGTATCCGCCGGAAGAAGGCTGCGGCCAGAAACACCACCGTCTCCGTCGCCGCCGGCGTCTACCCCTTCCACTCC...

CDS

Download CDS FASTA

1590 bp · LXL04_018111|LXL04_018111|OH1004|CDS

ATGGATGTATATGAATCAAATCAAGCTTTAGAGACCCGAAAGAACAATGGAAGAATTCATCGGGAAATCAGTTCCAGTTCGAGGTACAAATCACCTACACCACGGCGTTTTCCATCCCCAAATGCAAGAACAACAGTTACAAGTACAAGTACAAGTACAACGTCGGCGCCGATATCAAAGAGAGCTGTATCCGCCGGAAGAAGGCTGCGGCCAGAAACACCACCGTCTCCGTCGCCGCCGGCGTCTACCCCTTCCACTCC...

Protein

Download Protein FASTA

529 aa · LXL04_018111|LXL04_018111|OH1004|PROTEIN

MDVYESNQALETRKNNGRIHREISSSSRYKSPTPRRFPSPNARTTVTSTSTSTTSAPISKRAVSAGRRLRPETPPSPSPPASTPSTPVHDTSIYTDLAARKASSSKLPESLWPSRMRSLNVAFQSNAFSMPISKKEKPPPQVIFDRTLKPSSNVGYKPTVTPPTYRKATPERNRSPLKGKNTIDHLENSKPFDRFDHHRWPNRTGSNSNVLAKNNDLPGSPVTPKSTNDSPRKISSLSHNPHRVSNVFAEKNAVRSQSPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018111`
TK1151 ID	TkA08G026340
OH-1004 ID	LXL04_018111
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018111

Location Chr04:6814065-6816637 (-)

Description Similar to QWRF4: QWRF motif-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24070`	QWRF motif-containing protein 4.	No verified direct reference in this release
`At4g30710`	Contributes to the assembly of the acentrosomal spindle and phragmoplast microtubule arrays as part of the augmin complex.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610
`At3g19570`	Probable microtubule-associated peroxisomal protein required for chloroplast biogenesis and for the formation of the prolamellar body and prothylakoids in etioplasts.	No verified direct reference in this release
`At1g49890`	QWRF motif-containing protein 2.	No verified direct reference in this release
`At5g43160`	QWRF motif-containing protein 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018111 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005880 nuclear microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT2G24070

ath:AT3G19570

ath:AT4G30710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.645

Rank 1 · LXL04_018111 · OH-1004

Nucleus0.314

Rank 2 · LXL04_018111 · OH-1004

Cell membrane0.149

Rank 3 · LXL04_018111 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_018111 · OH-1004

Plastid0.037

Rank 5 · LXL04_018111 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04484.19QWRF208-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018111	`PF04484.19`	QWRF	208	496	1.2e-77	262.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4INP9`	Arabidopsis thaliana	QWRF motif-containing protein 4	46.899%	Swiss-Prot	weak database homology
`Q9SUH5`	Arabidopsis thaliana	AUGMIN subunit 8	44.961%	Swiss-Prot	weak database homology
`Q8GXD9`	Arabidopsis thaliana	Protein SNOWY COTYLEDON 3	41.606%	Swiss-Prot	moderate database homology
`Q94AI1`	Arabidopsis thaliana	QWRF motif-containing protein 2	42.007%	Swiss-Prot	moderate database homology
`F4K4M0`	Arabidopsis thaliana	QWRF motif-containing protein 9	39.792%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card