LXL04_016334 | RubberDandelionOmics

Gene overview

LXL04_016334

Reference: OH-1004 Chr: Chr03 Coordinates: 119179897-119182433 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1583 bp · LXL04_016334|LXL04_016334|OH1004|cDNA

ATGGAAGCCGATCGAGAAGAAGGATGCAATGTGCTGTTCGTATGGAAGCCGATGGAGAAGAAGGGTGCAATGTCGGTAGAGGTCGCTGTTGAAAGCCTTGCGGGAAGTGAGCGAGCTGTATGGAGAAGAAGGATATGGAAGCCGATAGAGAAGAAGGGTGCAATGTCGGTGAAGAAAGCGGTGGGGAAAAGGAAGCCGGTAGAAGTTGCTGGAAAACCATTGTTGTTGGATATGAATCGGAGCAGGGGGTTGTTGTTGGA...

CDS

Download CDS FASTA

1569 bp · LXL04_016334|LXL04_016334|OH1004|CDS

ATGGAAGCCGATCGAGAAGAAGGATGCAATGTGCTGTTCGTATGGAAGCCGATGGAGAAGAAGGGTGCAATGTCGGTAGAGGTCGCTGTTGAAAGCCTTGCGGGAAGTGAGCGAGCTGTATGGAGAAGAAGGATATGGAAGCCGATAGAGAAGAAGGGTGCAATGTCGGTGAAGAAAGCGGTGGGGAAAAGGAAGCCGGTAGAAGTTGCTGGAAAACCATTGTTGTTGGATATGAATCGGAGCAGGGGGTTGTTGTTGGA...

Protein

Download Protein FASTA

522 aa · LXL04_016334|LXL04_016334|OH1004|PROTEIN

MEADREEGCNVLFVWKPMEKKGAMSVEVAVESLAGSERAVWRRRIWKPIEKKGAMSVKKAVGKRKPVEVAGKPLLLDMNRSRGLLLDMNRSRGWYCRTRPRDLVGSLSTSMKFGKDCSFLSISGSLFHIYTSIALLQSKVYDWRRNKVIFIFDLIKSNLAVFPANAAVSERTESLLSLHSDSLQPLTPAVFYSVSPVRSPLSSVLLPFCFSGFVYRLSVADGNEGNFETTYSSNAMPALKKTEPGDIRQLFERFDEGDRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016334`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016334

Location Chr03:119179897-119182433 (-)

Description Similar to ASHH3: Histone-lysine N-methyltransferase ASHH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44150`	Histone methyltransferase.	No verified direct reference in this release
`At3g59960`	Histone methyltransferase.	No verified direct reference in this release
`At4g30860`	Histone methyltransferase (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016334 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0007281 germ cell development Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010569 regulation of double-strand break repair via homologous recombination Biological Process

GO:0010793 regulation of mRNA export from nucleus Biological Process

GO:0018023 peptidyl-lysine trimethylation Biological Process

KEGG gene cross-reference

ath:AT2G44150

ath:AT4G30860

dme:Dmel_CG1716

hsa:29072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.484

Rank 1 · LXL04_016334 · OH-1004

Cytoplasm0.375

Rank 2 · LXL04_016334 · OH-1004

Cell membrane0.104

Rank 3 · LXL04_016334 · OH-1004

Mitochondrion0.093

Rank 4 · LXL04_016334 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_016334 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856.34SET339-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016334	`PF00856.34`	SET	339	445	1.5e-26	93.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945S8`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ASHH3	74.895%	Swiss-Prot	weak database homology
`Q9M1X9`	Arabidopsis thaliana	Putative histone-lysine N-methyltransferase ASHH4	72.273%	Swiss-Prot	weak database homology
`Q949T8`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ASHR3	49.302%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card