Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1269 bp · LXL04_015951|LXL04_015951|OH1004|cDNA
ATGAGCTTGTCCACCGAACAGTTTACACCACATCGGAGTCTACGATTTGAGTTGCCGGCAAGTGGAGGTTGCTCTCGTCTGCTTCCTCTTCGACCTCTAAAACTAAAGGTTTGTTCGCTTATCTTGTTTATAGAAATGGTAGACTTGGAGGATATTCAGCCCATTGTTTGTGATGCTGGAACTGGAATGGTGAAGGCCGGGTTTGCCGGTGATGATGCTCCTAGGGTGGTGTCCCCCAATATTGTGGGTAGGCCACGGCA...
1269 bp · LXL04_015951|LXL04_015951|OH1004|CDS
ATGAGCTTGTCCACCGAACAGTTTACACCACATCGGAGTCTACGATTTGAGTTGCCGGCAAGTGGAGGTTGCTCTCGTCTGCTTCCTCTTCGACCTCTAAAACTAAAGGTTTGTTCGCTTATCTTGTTTATAGAAATGGTAGACTTGGAGGATATTCAGCCCATTGTTTGTGATGCTGGAACTGGAATGGTGAAGGCCGGGTTTGCCGGTGATGATGCTCCTAGGGTGGTGTCCCCCAATATTGTGGGTAGGCCACGGCA...
Protein
Download Protein FASTA422 aa · LXL04_015951|LXL04_015951|OH1004|PROTEIN
MSLSTEQFTPHRSLRFELPASGGCSRLLPLRPLKLKVCSLILFIEMVDLEDIQPIVCDAGTGMVKAGFAGDDAPRVVSPNIVGRPRHTGVMVGMSQKDAYVADEAMSERGMLTLRYPIEHGIVSNWDDMEKIWHHTFCNELRIAPEEQPVLLTEAPLNPKANREKMTQIMFETFNVPSMYIAIGAVLSLYASGRTTGIMMDSGEGVTHTVPVYEGHVLPHAILRLNLAGSILTDCLMRILTERGYAFTTTAEREMVRDVK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015951 |
|---|---|
| TK1151 ID | TkA02G269360 |
| OH-1004 ID | LXL04_015951 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 96.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 89.336Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015951 | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:100159606-100163105 (-) | |||||||||||||||
| Description | Similar to ACT3: Actin-3 | |||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| |||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||||||||
| GO annotations (OH1004 source) | GO:0006893 Golgi to plasma membrane transport Biological Process GO:0008104 intracellular protein localization Biological Process GO:0009416 response to light stimulus Biological Process GO:0009611 response to wounding Biological Process GO:0009733 response to auxin Biological Process GO:0009845 seed germination Biological Process GO:0010053 root epidermal cell differentiation Biological Process GO:0015031 protein transport Biological Process GO:0048364 root development Biological Process GO:0048767 root hair elongation Biological Process GO:0051301 cell division Biological Process GO:0005730 nucleolus Cellular Component | |||||||||||||||
| KEGG gene cross-reference | ath:AT5G09810 dosa:Os03g0836000 ghi:107932458 ghi:107953109 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00022.27Actin50-422 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015951 | PF00022.27 | Actin | 50 | 422 | 1.2e-136 | 456.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.