LXL04_015388 | RubberDandelionOmics

Gene overview

LXL04_015388

Reference: OH-1004 Chr: Chr03 Coordinates: 70349547-70361086 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6405 bp · LXL04_015388|LXL04_015388|OH1004|cDNA

atGAATTATACAACATACAAAGTTGGTGAGTCTTCGTCGGCTGCTACGAATGGTAGCACTGTTAGTTCTTCCGTCCCTGCGTCTTTGCCTTTTCTGCAATCTTTTGTGGAAGACCAATCGACCATTTGTCCGACCTCAGCTCCCCTTCCGTCATGCAATCCAACTTCTCATGTTCGCCGTCGTCGTCGTGGTAGAACGACAGGATACGCAGATCTTTCACCTTCGACCATTTCTTCTACTTCTGAGCCGTCAAATATTGG...

CDS

Download CDS FASTA

6405 bp · LXL04_015388|LXL04_015388|OH1004|CDS

ATGAATTATACAACATACAAAGTTGGTGAGTCTTCGTCGGCTGCTACGAATGGTAGCACTGTTAGTTCTTCCGTCCCTGCGTCTTTGCCTTTTCTGCAATCTTTTGTGGAAGACCAATCGACCATTTGTCCGACCTCAGCTCCCCTTCCGTCATGCAATCCAACTTCTCATGTTCGCCGTCGTCGTCGTGGTAGAACGACAGGATACGCAGATCTTTCACCTTCGACCATTTCTTCTACTTCTGAGCCGTCAAATATTGG...

Protein

Download Protein FASTA

2134 aa · LXL04_015388|LXL04_015388|OH1004|PROTEIN

MNYTTYKVGESSSAATNGSTVSSSVPASLPFLQSFVEDQSTICPTSAPLPSCNPTSHVRRRRRGRTTGYADLSPSTISSTSEPSNIGLLPTFASVSHRRSTRRRVSTPVVSPPNVVGFTVPLSGPCPQNRRPRGRPRPLQQQPSISGDVMFGISLPAYVDCGDAIYTCSKCNAFFWYAERVIRDSTVSNPVYKQCCKLGAVFLSLPLDPPPLLAALFADTRFMDNIRAYNSMFAMTSFGAKIDDSLNIGHGPYIFKISGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015388`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_015388`
Location	Chr03:70349547-70361086 (+)
Description	Similar to pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015388` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0001117 protein-DNA-RNA complex disassembly Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0042645 mitochondrial nucleoid Cellular Component GO:0000287 magnesium ion binding Molecular Function
KEGG gene cross-reference	hsa:80119 mmu:208084 rno:367645 xla:734585 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.914

Rank 1 · LXL04_015388 · OH-1004

Cytoplasm0.178

Rank 2 · LXL04_015388 · OH-1004

Mitochondrion0.036

Rank 3 · LXL04_015388 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_015388 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_015388 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14214.12Helitron_like_N436-619 aa

PF05970.21PIF11230-1279 aa

PF05970.21PIF11277-1412 aa

PF21530.4Pif1_2B_dom1514-1560 aa

PF02689.21Herpes_Helicase1607-1651 aa

PF08646.17Rep_fac-A_C1940-2071 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015388	`PF14214.12`	Helitron_like_N	436	619	3.3e-58	197.7
LXL04_015388	`PF05970.21`	PIF1	1230	1279	2.4e-51	175.2
LXL04_015388	`PF05970.21`	PIF1	1277	1412	2.4e-51	175.2
LXL04_015388	`PF21530.4`	Pif1_2B_dom	1514	1560	1.4e-15	57.4
LXL04_015388	`PF02689.21`	Herpes_Helicase	1607	1651	7.3e-07	28.3
LXL04_015388	`PF08646.17`	Rep_fac-A_C	1940	2071	1.3e-06	29.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card