LXL04_015270 | RubberDandelionOmics

Gene overview

LXL04_015270

Reference: OH-1004 Chr: Chr03 Coordinates: 67332041-67334146 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · LXL04_015270|LXL04_015270|OH1004|cDNA

ATGGATACTTCCTTGAGATACGGTGGAGAATCAAGCGCCCTCAGTATCACTACAAACAAGAATCCTCCTACGGTGAAGTACGCCGGAGATGTTAGTGCCCTCAAAATCCATGCTAAGCAGAAACTCCGAATCGATTCCAACACTCTACTTCAGCTTAACGGAGAGCTTGATACAGGGACTGGGCTTCCAACATTTTTTTGTGCACTCGTTAGACACTCCTATCCTAATCTTTCAGCTAGTCTTGGAGCTGGATTGCATTA...

CDS

Download CDS FASTA

564 bp · LXL04_015270|LXL04_015270|OH1004|CDS

ATGGATACTTCCTTGAGATACGGTGGAGAATCAAGCGCCCTCAGTATCACTACAAACAAGAATCCTCCTACGGTGAAGTACGCCGGAGATGTTAGTGCCCTCAAAATCCATGCTAAGCAGAAACTCCGAATCGATTCCAACACTCTACTTCAGCTTAACGGAGAGCTTGATACAGGGACTGGGCTTCCAACATTTTTTTGTGCACTCGTTAGACACTCCTATCCTAATCTTTCAGCTAGTCTTGGAGCTGGATTGCATTA...

Protein

Download Protein FASTA

187 aa · LXL04_015270|LXL04_015270|OH1004|PROTEIN

MDTSLRYGGESSALSITTNKNPPTVKYAGDVSALKIHAKQKLRIDSNTLLQLNGELDTGTGLPTFFCALVRHSYPNLSASLGAGLHYDKNQKLNCILRGKKAYPVAFKRNVNFVLKGYCNIDQELTQPTPHGALELVWNILDFQKDQDVRLKVGMEFVDKIPYVQIRENNWTFNADINGRWNVRYHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015270`
TK1151 ID	TkA02G349380
OH-1004 ID	LXL04_015270
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015270

Location Chr03:67332041-67334146 (+)

Description Similar to OEP21B: Outer envelope pore protein 21B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76405`	Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosephosphate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels) (By similarity).	No verified direct reference in this release
`At1g20816`	Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosephosphate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels) (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AFI8`	Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosephosphate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels) (By similarity).	No verified direct reference in this release
`Os02g0832200`	Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosephosphate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels) (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015270 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0044070 regulation of monoatomic anion transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0034426 etioplast membrane Cellular Component

GO:0046930 pore complex Cellular Component

GO:0008308 voltage-gated monoatomic anion channel activity Molecular Function

GO:0015288 porin activity Molecular Function

KEGG gene cross-reference

ath:AT1G20816

ath:AT1G76405

dosa:Os02g0832200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.638

Rank 1 · LXL04_015270 · OH-1004

Mitochondrion0.323

Rank 2 · LXL04_015270 · OH-1004

Cytoplasm0.038

Rank 3 · LXL04_015270 · OH-1004

Extracellular0.024

Rank 4 · LXL04_015270 · OH-1004

Nucleus0.018

Rank 5 · LXL04_015270 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30985.1OEP2125-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015270	`PF30985.1`	OEP21	25	187	3e-73	246.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPG2`	Arabidopsis thaliana	Outer envelope pore protein 21B, chloroplastic	57.317%	Swiss-Prot	strong database homology
`Q6ID99`	Arabidopsis thaliana	Outer envelope pore protein 21A, chloroplastic	54.268%	Swiss-Prot	strong database homology
`B8AFI8`	Oryza sativa subsp. indica	Outer envelope pore protein 21, chloroplastic	43.434%	Swiss-Prot	moderate database homology
`Q6K965`	Oryza sativa subsp. japonica	Outer envelope pore protein 21, chloroplastic	42.929%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card