LXL04_014558 | RubberDandelionOmics

Gene overview

LXL04_014558

Reference: OH-1004 Chr: Chr03 Coordinates: 52472946-52475444 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2499 bp · LXL04_014558|LXL04_014558|OH1004|cDNA

ATGCATCTCCACCACCTATGTTTTGTTTTACCATTTGACGGCGATGACATTCACCCATTTGATCACCATAAACGCCACCTCCCTCCCTCTAAatcaccaccaccatcaccaccatcATCTAAGAGTCGATCATGTGGTGTTAACCTACAAGAGGTCTTCCGTAAAACACTTCACAAATTCTGTGTAAAAGCACCGCCGGCCATCTACCATGACACCGACGGAGTCCAATTTTCTAAAGAGACGAGTGTTGCCGGCCACAG...

CDS

Download CDS FASTA

2499 bp · LXL04_014558|LXL04_014558|OH1004|CDS

ATGCATCTCCACCACCTATGTTTTGTTTTACCATTTGACGGCGATGACATTCACCCATTTGATCACCATAAACGCCACCTCCCTCCCTCTAAATCACCACCACCATCACCACCATCATCTAAGAGTCGATCATGTGGTGTTAACCTACAAGAGGTCTTCCGTAAAACACTTCACAAATTCTGTGTAAAAGCACCGCCGGCCATCTACCATGACACCGACGGAGTCCAATTTTCTAAAGAGACGAGTGTTGCCGGCCACAG...

Protein

Download Protein FASTA

832 aa · LXL04_014558|LXL04_014558|OH1004|PROTEIN

MHLHHLCFVLPFDGDDIHPFDHHKRHLPPSKSPPPSPPSSKSRSCGVNLQEVFRKTLHKFCVKAPPAIYHDTDGVQFSKETSVAGHSPKTFTYSELYIATKGFSQDEILGSGGFGRVFRAVLPSDGTVVAVKCLAETGERFEKSFAAELVAVAHLRHRNLVPLRGWCVHDDQLLLVYDYMPNRSLDRLLFRQVEKNGQAVAPVLSWERRMKIVKGLAAALFYLHEQLEAQIIHRDVKTSNVMLDTHFNARLGDFGLARWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014558`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014558

Location Chr03:52472946-52475444 (-)

Description Similar to LECRKS2: Receptor like protein kinase S.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32800`	Receptor like protein kinase S.2.	No verified direct reference in this release
`At3g53810`	Required during pollen development.	No verified direct reference in this release
`At5g59260`	Probable L-type lectin-domain containing receptor kinase II.1.	No verified direct reference in this release
`At4g02410`	L-type lectin-domain containing receptor kinase IV.3.	No verified direct reference in this release
`At4g02420`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014558 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32800

ath:AT3G53810

ath:AT5G59260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.681

Rank 1 · LXL04_014558 · OH-1004

Cytoplasm0.247

Rank 2 · LXL04_014558 · OH-1004

Nucleus0.240

Rank 3 · LXL04_014558 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_014558 · OH-1004

Golgi apparatus0.025

Rank 5 · LXL04_014558 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase104-330 aa

PF07714.24PK_Tyr_Ser-Thr105-399 aa

PF07714.24PK_Tyr_Ser-Thr520-792 aa

PF00069.32Pkinase527-790 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014558	`PF00069.32`	Pkinase	104	330	1.5e-63	215.3
LXL04_014558	`PF07714.24`	PK_Tyr_Ser-Thr	105	399	1.1e-67	228.8
LXL04_014558	`PF07714.24`	PK_Tyr_Ser-Thr	520	792	1.1e-67	228.8
LXL04_014558	`PF00069.32`	Pkinase	527	790	1.5e-63	215.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48837`	Arabidopsis thaliana	Receptor like protein kinase S.2	55.275%	Swiss-Prot	strong database homology
`Q9M345`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.2	44.548%	Swiss-Prot	weak database homology
`Q9FIF1`	Arabidopsis thaliana	Probable L-type lectin-domain containing receptor kinase II.1	37.621%	Swiss-Prot	weak database homology
`O81292`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.3	41.713%	Swiss-Prot	weak database homology
`O81291`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.4	41.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card