LXL04_013166 | RubberDandelionOmics

Gene overview

LXL04_013166

Reference: OH-1004 Chr: Chr03 Coordinates: 25270403-25272349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_013166|LXL04_013166|OH1004|cDNA

ATGGATTCTTCGGTTATCATGTCGTCAATTGTAGCGAGAACCGGTCGCCATCTCCAGCGTTACGACAACAATCTACGCCTTGTTTCTGGGTGTATTCCATACAGACTGGTGAAGATCAAAGATCAACACAATGATAAGGAGAACAAAATTGAAGTATTGATGGTATCTTCCCCAAATCGCGATGACATGGTGTTCCCAAAGGGTGGATGGGAGAGTGACGAGACAGTTGAAGAAGCTGCATGTCGTGAAGCCTTAGAGGA...

CDS

Download CDS FASTA

645 bp · LXL04_013166|LXL04_013166|OH1004|CDS

ATGGATTCTTCGGTTATCATGTCGTCAATTGTAGCGAGAACCGGTCGCCATCTCCAGCGTTACGACAACAATCTACGCCTTGTTTCTGGGTGTATTCCATACAGACTGGTGAAGATCAAAGATCAACACAATGATAAGGAGAACAAAATTGAAGTATTGATGGTATCTTCCCCAAATCGCGATGACATGGTGTTCCCAAAGGGTGGATGGGAGAGTGACGAGACAGTTGAAGAAGCTGCATGTCGTGAAGCCTTAGAGGA...

Protein

Download Protein FASTA

214 aa · LXL04_013166|LXL04_013166|OH1004|PROTEIN

MDSSVIMSSIVARTGRHLQRYDNNLRLVSGCIPYRLVKIKDQHNDKENKIEVLMVSSPNRDDMVFPKGGWESDETVEEAACREALEEAGVRGLLKGKPLGVWEFRSKSRQEACSEEGGCKGYMFALEVTEELQAWPEQGNRSRKWVVIEEAFVLCRYEWMQSALREFERMVENGIDEEQQKQEGDDCQLMSTNCHVNGPMTNSYGIMLPASIFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013166`
TK1151 ID	TkA02G513820
OH-1004 ID	LXL04_013166
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.196 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013166

Location Chr03:25270403-25272349 (-)

Description Similar to NUDT13: Nudix hydrolase 13, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26690`	Mediates the hydrolysis of some nucleoside diphosphate derivatives.	Cloning and characterization of AtNUDT13, a novel mitochondrial Arabidopsis thaliana Nudix hydrolase specific for long-chain diadenosine polyphosphates.2007 · DOI: 10.1111/j.1742-4658.2007.06009.x
`At1g12880`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At3g12600`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At1g18300`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At1g14860`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013166 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000210 NAD+ diphosphatase activity Molecular Function

GO:0016462 pyrophosphatase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0034432 bis(5'-adenosyl)-pentaphosphatase activity Molecular Function

GO:0035529 NADH pyrophosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12880

ath:AT1G14860

ath:AT1G18300

ath:AT3G12600

ath:AT3G26690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.642

Rank 1 · LXL04_013166 · OH-1004

Cytoplasm0.341

Rank 2 · LXL04_013166 · OH-1004

Plastid0.052

Rank 3 · LXL04_013166 · OH-1004

Endoplasmic reticulum0.051

Rank 4 · LXL04_013166 · OH-1004

Cell membrane0.051

Rank 5 · LXL04_013166 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293.35NUDIX48-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013166	`PF00293.35`	NUDIX	48	157	6.9e-12	46.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q52K88`	Arabidopsis thaliana	Nudix hydrolase 13, mitochondrial	66.292%	Swiss-Prot	strong database homology
`Q93ZY7`	Arabidopsis thaliana	Nudix hydrolase 12, mitochondrial	65.497%	Swiss-Prot	strong database homology
`Q9LHK1`	Arabidopsis thaliana	Nudix hydrolase 16, mitochondrial	55.901%	Swiss-Prot	strong database homology
`Q9LE73`	Arabidopsis thaliana	Nudix hydrolase 4	48.125%	Swiss-Prot	moderate database homology
`Q9LQU5`	Arabidopsis thaliana	Nudix hydrolase 18, mitochondrial	48.101%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card