LXL04_012956 | RubberDandelionOmics

Gene overview

LXL04_012956

Reference: OH-1004 Chr: Chr03 Coordinates: 21594537-21596303 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · LXL04_012956|LXL04_012956|OH1004|cDNA

ATGGCTCAATTATCCGAACCCGAACGGTCTCCGAGTGTTCAACAAAGGGGTTTTCGACTTCAAGCTCCACTGGTGGAGTCTGTTTCATGCTACTGTAGAGTCGATGCAAGCTTAAAAACAGTAGCCGGAGCCAGAAAATTTGTCCCCGGGTCAAAGCTCTGCATCCAACCCGACATCAACCCACGTGCCCACAAATCCAAAAACAGTCGCAGAGAACGAACCAGGGTCCAACCCCCTCTCATCCCCGGTCTCCCCGACGA...

CDS

Download CDS FASTA

1323 bp · LXL04_012956|LXL04_012956|OH1004|CDS

ATGGCTCAATTATCCGAACCCGAACGGTCTCCGAGTGTTCAACAAAGGGGTTTTCGACTTCAAGCTCCACTGGTGGAGTCTGTTTCATGCTACTGTAGAGTCGATGCAAGCTTAAAAACAGTAGCCGGAGCCAGAAAATTTGTCCCCGGGTCAAAGCTCTGCATCCAACCCGACATCAACCCACGTGCCCACAAATCCAAAAACAGTCGCAGAGAACGAACCAGGGTCCAACCCCCTCTCATCCCCGGTCTCCCCGACGA...

Protein

Download Protein FASTA

440 aa · LXL04_012956|LXL04_012956|OH1004|PROTEIN

MAQLSEPERSPSVQQRGFRLQAPLVESVSCYCRVDASLKTVAGARKFVPGSKLCIQPDINPRAHKSKNSRRERTRVQPPLIPGLPDDLAIACLIRVPRAEHNKLRLVCKRWFRLLSGNYFYSLRKTLGMAEEWVYVFKRDRDGRISWHAFDPTYQLWQPLPPVPVEYGSALGFGCAVLSGCHLYLFGGKDPIKGSMRRVVFYSARTNKWHRAPDMLRKRQFFGACVINNCLYVAGGECEGIHRTLRSAEVYDPNKHRWNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012956`
TK1151 ID	TkA02G526440
OH-1004 ID	LXL04_012956
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012956

Location Chr03:21594537-21596303 (+)

Description Similar to At1g55270: F-box/kelch-repeat protein At1g55270

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55270`	F-box/kelch-repeat protein At1g55270.	No verified direct reference in this release
`At1g22040`	F-box/kelch-repeat protein At1g22040.	No verified direct reference in this release
`At1g67480`	F-box/kelch-repeat protein At1g67480.	No verified direct reference in this release
`At1g30090`	F-box/kelch-repeat protein At1g30090.	No verified direct reference in this release
`At3g61350`	F-box/kelch-repeat protein SKIP4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012956 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009409 response to cold Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G22040

ath:AT1G30090

ath:AT1G55270

ath:AT1G67480

ath:AT3G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.677

Rank 1 · LXL04_012956 · OH-1004

Cytoplasm0.232

Rank 2 · LXL04_012956 · OH-1004

Cell membrane0.084

Rank 3 · LXL04_012956 · OH-1004

Plastid0.043

Rank 4 · LXL04_012956 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_012956 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24681.2Kelch_KLHDC2_KLHL20_DRC7146-307 aa

PF25210.2Kelch_FKB95173-377 aa

PF01344.32Kelch_1175-215 aa

PF13964.13Beta-prop_Calicin192-303 aa

PF01344.32Kelch_1219-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012956	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	146	307	1.3e-10	41.7
LXL04_012956	`PF25210.2`	Kelch_FKB95	173	377	4.6e-21	76.4
LXL04_012956	`PF01344.32`	Kelch_1	175	215	6.4e-20	71.1
LXL04_012956	`PF13964.13`	Beta-prop_Calicin	192	303	3.1e-11	43.6
LXL04_012956	`PF01344.32`	Kelch_1	219	265	6.4e-20	71.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W93`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g55270	76.027%	Swiss-Prot	strong database homology
`Q9LM55`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g22040	27.412%	Swiss-Prot	weak database homology
`Q9CAG8`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g67480	30.218%	Swiss-Prot	moderate database homology
`Q9C6Z0`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g30090	29.010%	Swiss-Prot	weak database homology
`Q9M2C9`	Arabidopsis thaliana	F-box/kelch-repeat protein SKIP4	27.134%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card