LXL04_011624 | RubberDandelionOmics

Gene overview

LXL04_011624

Reference: OH-1004 Chr: Chr02 Coordinates: 168431358-168434173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2055 bp · LXL04_011624|LXL04_011624|OH1004|cDNA

ATGGTGTATTTCGGATGGATGGAACAAGTTCTTACCACTTCTCTCATTCAAGATTTCATATTCGTGGCATATATTAACATTATAAGGGACTTATATGGAATTTATAAAGACTGCAGGGACTTGAATAAGAAACTAGCAATTTACAAATTGTTGCCCTCTATCCAGTTTGGGGCTTTGGGCAAAATCGTCCGACCACTGCCGCAAGTCACAGAGTTGCTCACTATCTACAGTGTGGTAGCTGCCGGAGGTCTCAGAGCGAT...

CDS

Download CDS FASTA

2055 bp · LXL04_011624|LXL04_011624|OH1004|CDS

ATGGTGTATTTCGGATGGATGGAACAAGTTCTTACCACTTCTCTCATTCAAGATTTCATATTCGTGGCATATATTAACATTATAAGGGACTTATATGGAATTTATAAAGACTGCAGGGACTTGAATAAGAAACTAGCAATTTACAAATTGTTGCCCTCTATCCAGTTTGGGGCTTTGGGCAAAATCGTCCGACCACTGCCGCAAGTCACAGAGTTGCTCACTATCTACAGTGTGGTAGCTGCCGGAGGTCTCAGAGCGAT...

Protein

Download Protein FASTA

684 aa · LXL04_011624|LXL04_011624|OH1004|PROTEIN

MVYFGWMEQVLTTSLIQDFIFVAYINIIRDLYGIYKDCRDLNKKLAIYKLLPSIQFGALGKIVRPLPQVTELLTIYSVVAAGGLRAMILSSIAPAFHTHQHKDLLRQVVYRPATTTTAVHCSYPNNAAALRHVSSSNNNNGNTNTCEDDVVTVSSACAIAAAIRKASTSPVEFVQRIEQNGKNKGIVLPSSDFQTLCMEQLDLFRRIVDPEALLSVYVRPAGSYVMDRLELRRVTVYPRRNVTDVVIVIGNFSIPAGLRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011624`
TK1151 ID	TkA03G606580
OH-1004 ID	LXL04_011624
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 93.860 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011624

Location Chr02:168431358-168434173 (-)

Description Similar to CSK: Chloroplast sensor kinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67840`	Sensor kinase that senses the plastoquinone (PQ) redox state involved in stoichiometry adjustment of both photosystems (e.g. long-term adaptation via transcriptional regulation of reaction center genes of photosystems I and II) and state transitions (e.g. short-term adaptation involving reversible post-translational phosphorylation of light-harvesting complex II, LHC II), thus linking photosynthesis with gene expression in chloroplasts.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011624 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010109 regulation of photosynthesis Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051776 detection of redox state Biological Process

GO:0080005 photosystem stoichiometry adjustment Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004673 protein histidine kinase activity Molecular Function

GO:0004715 non-membrane spanning protein tyrosine kinase activity Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0048038 quinone binding Molecular Function

KEGG gene cross-reference

ath:AT1G67840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.225

Rank 1 · LXL04_011624 · OH-1004

Cell membrane0.199

Rank 2 · LXL04_011624 · OH-1004

Cytoplasm0.196

Rank 3 · LXL04_011624 · OH-1004

Plastid0.187

Rank 4 · LXL04_011624 · OH-1004

Endoplasmic reticulum0.113

Rank 5 · LXL04_011624 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVG8`	Arabidopsis thaliana	Chloroplast sensor kinase, chloroplastic	63.931%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card