LXL04_010289 | RubberDandelionOmics

Gene overview

LXL04_010289

Reference: OH-1004 Chr: Chr02 Coordinates: 143715252-143716853 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_010289|LXL04_010289|OH1004|cDNA

ATGTTCAAATCCAAGCCGGCCTACACCACTCTTCAAGACCACCAATGGCAGCCATCCCATGGTTCCAATCATGTCCTCACTTCTGCTTCTTCCCAGAGATCATCTCCTTACACTTCTGGATGTGATGAAAGAACCCCGGAGCCAAAGCCAAGATGGAATCCGAAACCCGAACAAATCCGGATCCTTGAATCCATTTTCAACTCGGGAATGATAAATCCTCCACGAGATGAAATCAAAAAAATCCGAGCTCGATTGCAAGA...

CDS

Download CDS FASTA

1194 bp · LXL04_010289|LXL04_010289|OH1004|CDS

ATGTTCAAATCCAAGCCGGCCTACACCACTCTTCAAGACCACCAATGGCAGCCATCCCATGGTTCCAATCATGTCCTCACTTCTGCTTCTTCCCAGAGATCATCTCCTTACACTTCTGGATGTGATGAAAGAACCCCGGAGCCAAAGCCAAGATGGAATCCGAAACCCGAACAAATCCGGATCCTTGAATCCATTTTCAACTCGGGAATGATAAATCCTCCACGAGATGAAATCAAAAAAATCCGAGCTCGATTGCAAGA...

Protein

Download Protein FASTA

397 aa · LXL04_010289|LXL04_010289|OH1004|PROTEIN

MFKSKPAYTTLQDHQWQPSHGSNHVLTSASSQRSSPYTSGCDERTPEPKPRWNPKPEQIRILESIFNSGMINPPRDEIKKIRARLQEYGQVGDANVFYWFQNRKSRSKNKTRHLLKSQTRHSQIATKAATTTSSSSSDKSTSKSTEFLLNSPIVSVNQQPQPYIGGGGGTGTSDHQHHGDFFQESFYFPVVHQQTSLPPTTANCTQLEFSFPEVGTMINHETRRRNNDQTVVSSTDMLFTDLMMNHQYGVPNKNSKSKGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010289`
TK1151 ID	TkA03G517340
OH-1004 ID	LXL04_010289
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 97.423 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010289

Location Chr02:143715252-143716853 (-)

Description Similar to WOX7: WUSCHEL-related homeobox 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45980`	Probable transcription factor, which may be involved in embryonic patterning.	Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.2004 · DOI: 10.1242/dev.00963 Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development.2007 · DOI: 10.1016/j.ydbio.2007.07.019 WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05113.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0667400`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`Os05g0564500`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`Os07g0533100`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`Os07g0684900`	Transcription factor involved in crown root development.	The WUSCHEL-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice.2009 · DOI: 10.1105/tpc.108.061655 The Interaction between Rice ERF3 and WOX11 Promotes Crown Root Development by Regulating Gene Expression Involved in Cytokinin Signaling.2015 · DOI: 10.1105/tpc.15.00227 Rice Homeodomain Protein WOX11 Recruits a Histone Acetyltransferase Complex to Establish Programs of Cell Proliferation of Crown Root Meristem.2017 · DOI: 10.1105/tpc.16.00908 Transcriptional regulatory network of WOX11 is involved in the control of crown root development, cytokinin signals, and redox in rice.2017 · DOI: 10.1093/jxb/erx153 The YUCCA-Auxin-WOX11 Module Controls Crown Root Development in Rice.2018 · DOI: 10.3389/fpls.2018.00523

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010289 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030010 establishment of cell polarity Biological Process

GO:0048731 system development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0050793 regulation of developmental process Biological Process

GO:0090451 cotyledon boundary formation Biological Process

GO:1905393 plant organ formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT5G45980

dosa:Os01g0667400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_010289 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_010289 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_010289 · OH-1004

Endoplasmic reticulum0.031

Rank 4 · LXL04_010289 · OH-1004

Plastid0.014

Rank 5 · LXL04_010289 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain49-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010289	`PF00046.36`	Homeodomain	49	109	1.8e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6X7J5`	Arabidopsis thaliana	WUSCHEL-related homeobox 8	52.899%	Swiss-Prot	weak database homology
`Q0JKK6`	Oryza sativa subsp. japonica	WUSCHEL-related homeobox 7	80.000%	Swiss-Prot	weak database homology
`A3B6V0`	Oryza sativa subsp. japonica	WUSCHEL-related homeobox 12	78.750%	Swiss-Prot	weak database homology
`A3BKM2`	Oryza sativa subsp. japonica	WUSCHEL-related homeobox 13	78.049%	Swiss-Prot	weak database homology
`Q0D3I7`	Oryza sativa subsp. japonica	WUSCHEL-related homeobox 11	71.930%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card