LXL04_010093 | RubberDandelionOmics

Gene overview

LXL04_010093

Reference: OH-1004 Chr: Chr02 Coordinates: 139830927-139831489 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · LXL04_010093|LXL04_010093|OH1004|cDNA

ATGAAGAAGTTTCAGGAGAAGGAAAGCGCATTTGATTCCGAGTTAGCGTTCTTATCCAGACTTCATCACAAACACCTGAGCTCTATACGATCATGGACAATCAGAATCAAAATCGCATTAGATGCTTCCAAAGGAATCGAATACCTTCACAACTACGTCGTTCCTCCAATCATCCACCGGGGCATCAAATCCTCCAACATTCTTCTCGACGCAAATTGCATCGCTAAGGTTTCCGATTTCAGCTTATCTCTAATGAGCCT...

CDS

Download CDS FASTA

495 bp · LXL04_010093|LXL04_010093|OH1004|CDS

ATGAAGAAGTTTCAGGAGAAGGAAAGCGCATTTGATTCCGAGTTAGCGTTCTTATCCAGACTTCATCACAAACACCTGAGCTCTATACGATCATGGACAATCAGAATCAAAATCGCATTAGATGCTTCCAAAGGAATCGAATACCTTCACAACTACGTCGTTCCTCCAATCATCCACCGGGGCATCAAATCCTCCAACATTCTTCTCGACGCAAATTGCATCGCTAAGGTTTCCGATTTCAGCTTATCTCTAATGAGCCT...

Protein

Download Protein FASTA

164 aa · LXL04_010093|LXL04_010093|OH1004|PROTEIN

MKKFQEKESAFDSELAFLSRLHHKHLSSIRSWTIRIKIALDASKGIEYLHNYVVPPIIHRGIKSSNILLDANCIAKVSDFSLSLMSLVSNREYKLNILTAKNDVYGLGVVLLELLTSQRAIFKSSEINGGAPINLVDYAVPIIMAGELTKILDKRVGLPKVNEA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010093`
TK1151 ID	TkA03G497190
OH-1004 ID	LXL04_010093
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010093

Location Chr02:139830927-139831489 (+)

Description Similar to CCR3: Putative serine/threonine-protein kinase-like protein CCR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55950`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At5g47850`	Serine/threonine-protein kinase-like protein CCR4.	No verified direct reference in this release
`At3g59420`	Controls formative cell division in meristems, including root tips and lateral root initiation zones of the pericycle, in response to CLE40 signal.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0637800`	Receptor protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010093 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0048439 flower morphogenesis Biological Process

GO:0048829 root cap development Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0090392 sepal giant cell differentiation Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0099402 plant organ development Biological Process

KEGG gene cross-reference

ath:AT3G55950

ath:AT3G59420

ath:AT5G47850

dosa:Os03g0637800

zma:542346

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · LXL04_010093 · OH-1004

Cell membrane0.369

Rank 2 · LXL04_010093 · OH-1004

Nucleus0.253

Rank 3 · LXL04_010093 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_010093 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_010093 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase29-122 aa

PF07714.24PK_Tyr_Ser-Thr35-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010093	`PF00069.32`	Pkinase	29	122	2.7e-11	44.1
LXL04_010093	`PF07714.24`	PK_Tyr_Ser-Thr	35	85	1.6e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY50`	Arabidopsis thaliana	Putative serine/threonine-protein kinase-like protein CCR3	50.877%	Swiss-Prot	strong database homology
`Q9FIJ6`	Arabidopsis thaliana	Serine/threonine-protein kinase-like protein CCR4	40.291%	Swiss-Prot	moderate database homology
`Q9LX29`	Arabidopsis thaliana	Serine/threonine-protein kinase-like protein ACR4	35.211%	Swiss-Prot	moderate database homology
`Q75J39`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase-like protein CR4	38.728%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card