LXL04_010074 | RubberDandelionOmics

Gene overview

LXL04_010074

Reference: OH-1004 Chr: Chr02 Coordinates: 139375227-139386950 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2127 bp · LXL04_010074|LXL04_010074|OH1004|cDNA

ATGGAGGCTTTCGACCATCTCAGATTTCCACTAAAGATTATACTGCATGCGACCAAGAACTTTGGTGCTGAAAACTTCATAGCCGAGGGTGGATTCGGGAAGGTTTATAGAGGGGAATTCTCAAACACCATGGGTGCACTGTTTAATCGATTAATAGACAAAGCAGATGTTTCATTTCGGACTGAAATCATGTTTCTTACAAGTTGTTCACATGAAAATCTCATCTCACTCATGGGATTCTGTGATGAGGGTGAGAATAG...

CDS

Download CDS FASTA

2127 bp · LXL04_010074|LXL04_010074|OH1004|CDS

ATGGAGGCTTTCGACCATCTCAGATTTCCACTAAAGATTATACTGCATGCGACCAAGAACTTTGGTGCTGAAAACTTCATAGCCGAGGGTGGATTCGGGAAGGTTTATAGAGGGGAATTCTCAAACACCATGGGTGCACTGTTTAATCGATTAATAGACAAAGCAGATGTTTCATTTCGGACTGAAATCATGTTTCTTACAAGTTGTTCACATGAAAATCTCATCTCACTCATGGGATTCTGTGATGAGGGTGAGAATAG...

Protein

Download Protein FASTA

708 aa · LXL04_010074|LXL04_010074|OH1004|PROTEIN

MEAFDHLRFPLKIILHATKNFGAENFIAEGGFGKVYRGEFSNTMGALFNRLIDKADVSFRTEIMFLTSCSHENLISLMGFCDEGENRILVYEYADFGLSRHGPANQDRTFVFSEAKGTLGYCDPMYVEDMLLTKESDVYSFGVVLFEALCSRPCVEWKYTKYWSRSTTMKKDHYPTCRPKMESVVSKLKTALEFQEIFDVKIAEIGHRMSLNEIVFDFKPYKKTDVDHFRIPLEKIMDATKNFSAENFIAESRYGKVYRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010074`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010074

Location Chr02:139375227-139386950 (+)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010074 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G46290

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.654

Rank 1 · LXL04_010074 · OH-1004

Nucleus0.336

Rank 2 · LXL04_010074 · OH-1004

Cell membrane0.165

Rank 3 · LXL04_010074 · OH-1004

Endoplasmic reticulum0.051

Rank 4 · LXL04_010074 · OH-1004

Mitochondrion0.043

Rank 5 · LXL04_010074 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr26-94 aa

PF07714.24PK_Tyr_Ser-Thr94-185 aa

PF00069.32Pkinase94-159 aa

PF07714.24PK_Tyr_Ser-Thr247-510 aa

PF00069.32Pkinase252-507 aa

PF00462.31Glutaredoxin564-628 aa

PF23733.3GRXCR1-2_C659-701 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010074	`PF07714.24`	PK_Tyr_Ser-Thr	26	94	7.3e-40	137.6
LXL04_010074	`PF07714.24`	PK_Tyr_Ser-Thr	94	185	7.3e-40	137.6
LXL04_010074	`PF00069.32`	Pkinase	94	159	4.9e-33	115.4
LXL04_010074	`PF07714.24`	PK_Tyr_Ser-Thr	247	510	7.3e-40	137.6
LXL04_010074	`PF00069.32`	Pkinase	252	507	4.9e-33	115.4
LXL04_010074	`PF00462.31`	Glutaredoxin	564	628	1.9e-10	41.5
LXL04_010074	`PF23733.3`	GRXCR1-2_C	659	701	6.8e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	39.423%	Swiss-Prot	weak database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	40.468%	Swiss-Prot	weak database homology
`Q9T020`	Arabidopsis thaliana	Probable receptor-like protein kinase At4g39110	36.950%	Swiss-Prot	weak database homology
`Q9SA72`	Arabidopsis thaliana	Probable receptor-like protein kinase At1g30570	37.855%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	38.562%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card