LXL04_009664 | RubberDandelionOmics

Gene overview

LXL04_009664

Reference: OH-1004 Chr: Chr02 Coordinates: 130899823-130901037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · LXL04_009664|LXL04_009664|OH1004|cDNA

ATGACTGGAGAAAGGACAGTACATCCAGATTGCAGAAATTCTTCAAACCCATACCATGAATGCAGTCAATATTGCTTTCAAGTAATCACTGAAGCCAAGAAACTTGCTAGTATAAACGAACCAGCCAGCCTGCAAGCAACCCCTGTCCAAACTGAAACTCCTGACAATGAAAAAATCAATCCTGATAACCATCCAAGTGATGATGACAATGACAACAATGCCCCTGAGGAAGAACAACCCGAAGTGGACTTCACCAAGCT...

CDS

Download CDS FASTA

909 bp · LXL04_009664|LXL04_009664|OH1004|CDS

ATGACTGGAGAAAGGACAGTACATCCAGATTGCAGAAATTCTTCAAACCCATACCATGAATGCAGTCAATATTGCTTTCAAGTAATCACTGAAGCCAAGAAACTTGCTAGTATAAACGAACCAGCCAGCCTGCAAGCAACCCCTGTCCAAACTGAAACTCCTGACAATGAAAAAATCAATCCTGATAACCATCCAAGTGATGATGACAATGACAACAATGCCCCTGAGGAAGAACAACCCGAAGTGGACTTCACCAAGCT...

Protein

Download Protein FASTA

302 aa · LXL04_009664|LXL04_009664|OH1004|PROTEIN

MTGERTVHPDCRNSSNPYHECSQYCFQVITEAKKLASINEPASLQATPVQTETPDNEKINPDNHPSDDDNDNNAPEEEQPEVDFTKLTGKQKKLFEIRMKMNEARKANQTAMVAEKKRMEAPQELRGISKQKWIEERKKKIGKLLDSNGLDMSKAYMLDTQQTAQGKYKKWEKETAPAGWDVFNQKTLYDAYKKRTKKMDIDLEEYNKMKESDPEFYREASSLQYGKAPKISEDKIERMVKELKDRDEKKNTFSRRRRFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009664`
TK1151 ID	TkA03G461170
OH-1004 ID	LXL04_009664
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009664

Location Chr02:130899823-130901037 (-)

Description Similar to syf2: Pre-mRNA-splicing factor syf2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16860`	Involved in pre-mRNA splicing as component of the spliceosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009664 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0000974 Prp19 complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component

KEGG gene cross-reference

ath:AT2G16860

dre:445043

mmu:68592

rno:170933

xtr:496706

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.844

Rank 1 · LXL04_009664 · OH-1004

Cytoplasm0.205

Rank 2 · LXL04_009664 · OH-1004

Mitochondrion0.032

Rank 3 · LXL04_009664 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_009664 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_009664 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08231.18SYF2148-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009664	`PF08231.18`	SYF2	148	295	6e-36	124.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB80`	Arabidopsis thaliana	Pre-mRNA-splicing factor SYF2	67.657%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card