LXL04_009225 | RubberDandelionOmics

Gene overview

LXL04_009225

Reference: OH-1004 Chr: Chr02 Coordinates: 120916747-120918214 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

990 bp · LXL04_009225|LXL04_009225|OH1004|cDNA

ATGGAATATACAAGCTTGGTTGACACTTCATTGGATCTTAATTCGAATCCTTCCCACTTCCTCTCTCTTGTTCCTAAACAAGAAGTTAAGAGCAGCTTCATTGAGCTCGGATTAAAGATGTCATCTGTTAACGATCAGGCTGCTGGTGAATTGGTGGAGGAATTGAATAGGGTAAGTGCAGAAAACAAGAAACTTACAGAGATGTTGACTGTCATGTGTGAGAACTACAATGCTTTGCAAAACCATTTGACCGATTATAT...

CDS

Download CDS FASTA

990 bp · LXL04_009225|LXL04_009225|OH1004|CDS

ATGGAATATACAAGCTTGGTTGACACTTCATTGGATCTTAATTCGAATCCTTCCCACTTCCTCTCTCTTGTTCCTAAACAAGAAGTTAAGAGCAGCTTCATTGAGCTCGGATTAAAGATGTCATCTGTTAACGATCAGGCTGCTGGTGAATTGGTGGAGGAATTGAATAGGGTAAGTGCAGAAAACAAGAAACTTACAGAGATGTTGACTGTCATGTGTGAGAACTACAATGCTTTGCAAAACCATTTGACCGATTATAT...

Protein

Download Protein FASTA

329 aa · LXL04_009225|LXL04_009225|OH1004|PROTEIN

MEYTSLVDTSLDLNSNPSHFLSLVPKQEVKSSFIELGLKMSSVNDQAAGELVEELNRVSAENKKLTEMLTVMCENYNALQNHLTDYMSKNPAPSDSTNNNNNSKKRKPEIPVNQIINNERGVSESSSSDEDSCKKPRQEQHLKAKISRVCVRTEASDTGLLVKDGYQWRKYGQKVTRDNPSPRAYFKCSHAPTCPVKKKVQRSVEDQSILVATYEGEHNHPNQAKNEQVGTGMNRTCTVATATLGSVPCSASVSSSGPTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009225`
TK1151 ID	TkA03G411210
OH-1004 ID	LXL04_009225
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009225

Location Chr02:120916747-120918214 (+)

Description Similar to WRKY40: Probable WRKY transcription factor 40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80840`	Transcription factor (By similarity).	No verified direct reference in this release
`At4g31800`	Transcription factor.	Potentiation of developmentally regulated plant defense response by AtWRKY18, a pathogen-induced Arabidopsis transcription factor.2002 · DOI: 10.1104/pp.001057
`At2g25000`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q6IEK5`	Transcription repressor.	No verified direct reference in this release
`Os09g0417600`	Transcription repressor.	OsWRKY IIa Transcription Factors Modulate Rice Innate Immunity.2010 · DOI: 10.1007/s12284-010-9039-6

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009225 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010200 response to chitin Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G80840

ath:AT2G25000

ath:AT4G31800

dosa:Os09g0417600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · LXL04_009225 · OH-1004

Cytoplasm0.152

Rank 2 · LXL04_009225 · OH-1004

Mitochondrion0.020

Rank 3 · LXL04_009225 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_009225 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_009225 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY163-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009225	`PF03106.22`	WRKY	163	221	2.5e-25	89.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAH7`	Arabidopsis thaliana	Probable WRKY transcription factor 40	50.746%	Swiss-Prot	strong database homology
`Q9C5T4`	Arabidopsis thaliana	WRKY transcription factor 18	47.661%	Swiss-Prot	moderate database homology
`Q9SK33`	Arabidopsis thaliana	Probable WRKY transcription factor 60	43.302%	Swiss-Prot	moderate database homology
`Q6IEK5`	Oryza sativa subsp. indica	WRKY transcription factor WRKY76	44.068%	Swiss-Prot	moderate database homology
`Q6EPZ2`	Oryza sativa subsp. japonica	WRKY transcription factor WRKY76	44.595%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card