LXL04_009215 | RubberDandelionOmics

Gene overview

LXL04_009215

Reference: OH-1004 Chr: Chr02 Coordinates: 120613304-120614204 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

517 bp · LXL04_009215|LXL04_009215|OH1004|cDNA

atatataaaatgacatttttacccccttTAACTCATTGATAGTCGATTAACCTGTAAAAACACGTTCATATTATTAATAAACAGAACGACATAGATTTAGCGGTTGTCTCTGTTGTTAACAGCATCATCGATATTCTTGAGATCGGAATCTACAAGCAGAGCTGATTTCCCCCATGGATTTACATTCGGAACTGCTTCATCTGCCTTCCAGTTTGAAGGTGCGGTTGATGAAGGAAATAAAGGAGATAGCATCTGGGATA...

CDS

Download CDS FASTA

414 bp · LXL04_009215|LXL04_009215|OH1004|CDS

TTGTCTCTGTTGTTAACAGCATCATCGATATTCTTGAGATCGGAATCTACAAGCAGAGCTGATTTCCCCCATGGATTTACATTCGGAACTGCTTCATCTGCCTTCCAGTTTGAAGGTGCGGTTGATGAAGGAAATAAAGGAGATAGCATCTGGGATACTTTCTCAAGACTACCTGGAAGGATATTGGACTTCAGTAATGCGGATGAGGCTGTCGATCAATATCATCGATTCAAGGATGATATTGAATTGATGAAGAATTT...

Protein

Download Protein FASTA

137 aa · LXL04_009215|LXL04_009215|OH1004|PROTEIN

MSLLLTASSIFLRSESTSRADFPHGFTFGTASSAFQFEGAVDEGNKGDSIWDTFSRLPGRILDFSNADEAVDQYHRFKDDIELMKNLGMDAYRFSISWSRIFPNGTGKPNPQGIKYYNNLIDSLLEKGHYLLQFRFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009215`
TK1151 ID	TkA03G409900
OH-1004 ID	LXL04_009215
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 84.516 / OH-1004 95.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009215

Location Chr02:120613304-120614204 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54570`	Putative beta-glucosidase 41.	No verified direct reference in this release
`At1g26560`	Beta-glucosidase 40.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0683300`	Beta-glucosidase 25.	No verified direct reference in this release
`Os10g0323500`	Beta-glucosidase 34.	No verified direct reference in this release
`Os03g0212800`	Hydrolyzes glycosides, oligosaccharides and hydrophobic glycosides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009215 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0016798 hydrolase activity, acting on glycosyl bonds Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

GO:0047782 coniferin beta-glucosidase activity Molecular Function

GO:0080079 cellobiose glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26560

ath:AT5G54570

dosa:Os03g0212800

dosa:Os06g0683300

dosa:Os10g0323500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.401

Rank 1 · LXL04_009215 · OH-1004

Extracellular0.185

Rank 2 · LXL04_009215 · OH-1004

Lysosome / Vacuole0.086

Rank 3 · LXL04_009215 · OH-1004

Cytoplasm0.068

Rank 4 · LXL04_009215 · OH-1004

Mitochondrion0.061

Rank 5 · LXL04_009215 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232.25Glyco_hydro_120-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009215	`PF00232.25`	Glyco_hydro_1	20	128	3.2e-46	158.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIU7`	Arabidopsis thaliana	Putative beta-glucosidase 41	76.271%	Swiss-Prot	strong database homology
`Q9FZE0`	Arabidopsis thaliana	Beta-glucosidase 40	67.568%	Swiss-Prot	strong database homology
`Q0DA21`	Oryza sativa subsp. japonica	Beta-glucosidase 25	64.844%	Swiss-Prot	strong database homology
`Q339X2`	Oryza sativa subsp. japonica	Beta-glucosidase 34	60.769%	Swiss-Prot	strong database homology
`Q8L7J2`	Oryza sativa subsp. japonica	Beta-glucosidase 6	64.865%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card