LXL04_008553 | RubberDandelionOmics

Gene overview

LXL04_008553

Reference: OH-1004 Chr: Chr02 Coordinates: 102584643-102585994 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · LXL04_008553|LXL04_008553|OH1004|cDNA

ATGTGGAGACGACTGTCTACTCAACTTCGAATTCTCCGATCTGTTCAGAGATCTGATGTCATAAACAGTTCGTTTCCGTCGCCGGTGAGTCTCCGGCCATCCTCCGCAGTTATCTCTCGTCCAATCTCTTCAGTAACAGGAAAGTTTTCTAATAAGAGAGTCGAGGATATGATGCCTATTGCGACTGGTCACGAGCGTGAGGAGCTTCAAGCTGAGATTGAGGGACGCGATATTCTGGAAATCAACTTTCCTGAAGGTCC...

CDS

Download CDS FASTA

546 bp · LXL04_008553|LXL04_008553|OH1004|CDS

ATGTGGAGACGACTGTCTACTCAACTTCGAATTCTCCGATCTGTTCAGAGATCTGATGTCATAAACAGTTCGTTTCCGTCGCCGGTGAGTCTCCGGCCATCCTCCGCAGTTATCTCTCGTCCAATCTCTTCAGTAACAGGAAAGTTTTCTAATAAGAGAGTCGAGGATATGATGCCTATTGCGACTGGTCACGAGCGTGAGGAGCTTCAAGCTGAGATTGAGGGACGCGATATTCTGGAAATCAACTTTCCTGAAGGTCC...

Protein

Download Protein FASTA

181 aa · LXL04_008553|LXL04_008553|OH1004|PROTEIN

MWRRLSTQLRILRSVQRSDVINSSFPSPVSLRPSSAVISRPISSVTGKFSNKRVEDMMPIATGHEREELQAEIEGRDILEINFPEGPFGTKASTTLTVSDFAAPAVVKSYYDQRIVGCPGVEGEDEHDVVWFWLKKGEPHECPVCSQYFKTRGIDKCDDDDVWQLEVVGPGGLPDGLDQDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008553`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008553

Location Chr02:102584643-102585994 (+)

Description Similar to COX5B-2: Cytochrome c oxidase subunit 5b-2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80230`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release
`At3g15640`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release
`At1g52710`	Putative cytochrome c oxidase subunit 5b-like.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008553 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006123 mitochondrial electron transport, cytochrome c to oxygen Biological Process

GO:0007585 respiratory gaseous exchange by respiratory system Biological Process

GO:0045333 cellular respiration Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0045277 respiratory chain complex IV Cellular Component

GO:0004129 cytochrome-c oxidase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G52710

ath:AT1G80230

ath:AT3G15640

bta:287012

hsa:1329

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.826

Rank 1 · LXL04_008553 · OH-1004

Plastid0.144

Rank 2 · LXL04_008553 · OH-1004

Cytoplasm0.054

Rank 3 · LXL04_008553 · OH-1004

Nucleus0.051

Rank 4 · LXL04_008553 · OH-1004

Extracellular0.014

Rank 5 · LXL04_008553 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01215.25COX5B60-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008553	`PF01215.25`	COX5B	60	160	9.6e-15	55.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSB8`	Arabidopsis thaliana	Cytochrome c oxidase subunit 5b-2, mitochondrial	56.098%	Swiss-Prot	strong database homology
`Q9LW15`	Arabidopsis thaliana	Cytochrome c oxidase subunit 5b-1, mitochondrial	51.220%	Swiss-Prot	strong database homology
`Q9SSS5`	Arabidopsis thaliana	Putative cytochrome c oxidase subunit 5b-like	54.839%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card