LXL04_008521 | RubberDandelionOmics

Gene overview

LXL04_008521

Reference: OH-1004 Chr: Chr02 Coordinates: 101753591-101756641 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1182 bp · LXL04_008521|LXL04_008521|OH1004|cDNA

ATGGGTTCCTATGGAATGTTAGCAAAGAGAGCTGTGTTTACTGAAACACCCGTCATGGTTCAGATACAAGAATTGCTTCGAGGAATCAAGGGTGCTGTATCTCTAGCCCAGGGTGTTGTCTACTGGCAACCACCAAAACCAGCATTAGAGAAAGTGAAAGAGCTTGTTTGGGAGCCTTCAATCAGTCGATATGGTGCAGATGAAGGTCTTCCTGAGCTTCGAGAGGCATTGACTAAAAAGTTGCGTGAAGAAAATAAGTT...

CDS

Download CDS FASTA

1182 bp · LXL04_008521|LXL04_008521|OH1004|CDS

ATGGGTTCCTATGGAATGTTAGCAAAGAGAGCTGTGTTTACTGAAACACCCGTCATGGTTCAGATACAAGAATTGCTTCGAGGAATCAAGGGTGCTGTATCTCTAGCCCAGGGTGTTGTCTACTGGCAACCACCAAAACCAGCATTAGAGAAAGTGAAAGAGCTTGTTTGGGAGCCTTCAATCAGTCGATATGGTGCAGATGAAGGTCTTCCTGAGCTTCGAGAGGCATTGACTAAAAAGTTGCGTGAAGAAAATAAGTT...

Protein

Download Protein FASTA

393 aa · LXL04_008521|LXL04_008521|OH1004|PROTEIN

MGSYGMLAKRAVFTETPVMVQIQELLRGIKGAVSLAQGVVYWQPPKPALEKVKELVWEPSISRYGADEGLPELREALTKKLREENKLIKSSVMVTAGANQAFVNIVLALCDAGDSVVMFAPYYFNAYMSFQMTGVTNILVGPGDPKKLHPDADWLEKTLWETKPTPKLVTVVNPGNPSGTYIPEPLLKRISDICKKAGCWLVVDNTYEYFMYDGLKHTCIEGNHIVNIFSFSKAYGMMGWRVGYIAFPMDVEGLAPQLLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008521`
TK1151 ID	TkA03G363320
OH-1004 ID	LXL04_008521
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008521

Location Chr02:101753591-101756641 (+)

Description Similar to ISS1: Aromatic aminotransferase ISS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80360`	Coordinates and prevents auxin (IAA) and ethylene biosynthesis, thus regulating auxin homeostasis in young seedlings.	Coordination of auxin and ethylene biosynthesis by the aminotransferase VAS1.2013 · DOI: 10.1038/nchembio.1178 Auxin and Tryptophan Homeostasis Are Facilitated by the ISS1/VAS1 Aromatic Aminotransferase in Arabidopsis.2015 · DOI: 10.1534/genetics.115.180356
`At2g22250`	Prokaryotic-type aspartate aminotransferase.	Identification of a plant gene encoding glutamate/aspartate-prephenate aminotransferase: the last homeless enzyme of aromatic amino acids biosynthesis.2010 · DOI: 10.1016/j.febslet.2010.09.037

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006520 amino acid metabolic process Biological Process

GO:0006555 methionine metabolic process Biological Process

GO:0006569 L-tryptophan catabolic process Biological Process

GO:0009094 L-phenylalanine biosynthetic process Biological Process

GO:0009095 aromatic amino acid family biosynthetic process, prephenate pathway Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009693 ethylene biosynthetic process Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010366 negative regulation of ethylene biosynthetic process Biological Process

GO:1901997 negative regulation of indoleacetic acid biosynthetic process via tryptophan Biological Process

KEGG gene cross-reference

aae:aq_1969

ath:AT1G80360

ath:AT2G22250

tma:TM1255

tmi:THEMA_08060

tmm:Tmari_1260

tmw:THMA_1280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.453

Rank 1 · LXL04_008521 · OH-1004

Mitochondrion0.228

Rank 2 · LXL04_008521 · OH-1004

Peroxisome0.221

Rank 3 · LXL04_008521 · OH-1004

Nucleus0.145

Rank 4 · LXL04_008521 · OH-1004

Plastid0.069

Rank 5 · LXL04_008521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155.28Aminotran_1_233-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008521	`PF00155.28`	Aminotran_1_2	33	371	2.6e-51	175.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C969`	Arabidopsis thaliana	Aromatic aminotransferase ISS1	70.483%	Swiss-Prot	strong database homology
`Q9SIE1`	Arabidopsis thaliana	Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase	28.382%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card