RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_008502
Reference: OH-1004 Chr: Chr02 Coordinates: 101459021-101465956 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4278 bp · LXL04_008502|LXL04_008502|OH1004|cDNA

ATGTCCATTCTGCAAGAACTGGGCCATCTTAGAATCCCGCTTGAAGACATTAAACAGGCAACCAACAATTTTGATCGAAGAAATATTATCGGACCGCGTGATTATTATGGGGTGGTGTATACAGGAGTGCTTTCACACTTAAATGTGCCTACGAAGATTATAGCGAAGCGAGTTGATCAGAGTGCAAGTCATGATGAAAAGCATTTCTTAAATGAGATCAAAGTGCTCAGtttatataaacatgttaatATTGTCTCATT...

CDS

Download CDS FASTA

4278 bp · LXL04_008502|LXL04_008502|OH1004|CDS

ATGTCCATTCTGCAAGAACTGGGCCATCTTAGAATCCCGCTTGAAGACATTAAACAGGCAACCAACAATTTTGATCGAAGAAATATTATCGGACCGCGTGATTATTATGGGGTGGTGTATACAGGAGTGCTTTCACACTTAAATGTGCCTACGAAGATTATAGCGAAGCGAGTTGATCAGAGTGCAAGTCATGATGAAAAGCATTTCTTAAATGAGATCAAAGTGCTCAGTTTATATAAACATGTTAATATTGTCTCATT...

Protein

Download Protein FASTA

1425 aa · LXL04_008502|LXL04_008502|OH1004|PROTEIN

MSILQELGHLRIPLEDIKQATNNFDRRNIIGPRDYYGVVYTGVLSHLNVPTKIIAKRVDQSASHDEKHFLNEIKVLSLYKHVNIVSFLGFCDENDEKILVQEFVAYKSLDKFLSNSKLKWLQRLQICLGAARGLNYLHNGVGGHTLIHHSIRSRNIVFDDSWQPKITRLSYSILDQLHHTIDQGIIGKIEYIDPTFLQTGIVTKESDIYSFGVVLFEVLCGQLAYERKEDQIQYLCPSATHHYEIGKLNEIIDPMLRKQM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_008502
TK1151 IDTkA03G364250
OH-1004 IDLXL04_008502
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)68.300
Protein coverage (%)TK1151 99.134 / OH-1004 68.561
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_008502
LocationChr02:101459021-101465956 (+)
DescriptionSimilar to At2g39360: Probable receptor-like protein kinase At2g39360
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g39360 Probable receptor-like protein kinase At2g39360. No verified direct reference in this release
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008502 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0005576 extracellular region Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016324 apical plasma membrane Cellular Component
GO:0090404 pollen tube tip Cellular Component
GO:0099503 secretory vesicle Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT2G39360
ath:AT5G28680
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.570
Rank 1 · LXL04_008502 · OH-1004
Nucleus0.311
Rank 2 · LXL04_008502 · OH-1004
Cell membrane0.267
Rank 3 · LXL04_008502 · OH-1004
Endoplasmic reticulum0.050
Rank 4 · LXL04_008502 · OH-1004
Lysosome / Vacuole0.044
Rank 5 · LXL04_008502 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr35-293 aa
PF00069.32Pkinase36-292 aa
PF07714.24PK_Tyr_Ser-Thr355-660 aa
PF00069.32Pkinase396-658 aa
PF07714.24PK_Tyr_Ser-Thr690-957 aa
PF00069.32Pkinase728-955 aa
PF14299.14PP21052-1178 aa
PF14299.14PP21264-1424 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_008502PF07714.24PK_Tyr_Ser-Thr352931.1e-105353.3
LXL04_008502PF00069.32Pkinase362921.1e-86291.3
LXL04_008502PF07714.24PK_Tyr_Ser-Thr3556601.1e-105353.3
LXL04_008502PF00069.32Pkinase3966581.1e-86291.3
LXL04_008502PF07714.24PK_Tyr_Ser-Thr6909571.1e-105353.3
LXL04_008502PF00069.32Pkinase7289551.1e-86291.3
LXL04_008502PF14299.14PP2105211783.6e-32112.1
LXL04_008502PF14299.14PP2126414243.6e-32112.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O80623Arabidopsis thalianaProbable receptor-like protein kinase At2g3936039.583%Swiss-Protweak database homology
Q3E8W4Arabidopsis thalianaReceptor-like protein kinase ANXUR239.877%Swiss-Protweak database homology
Q9FID8Arabidopsis thalianaPutative receptor-like protein kinase At5g3900038.554%Swiss-Protweak database homology
Q9FN92Arabidopsis thalianaProbable receptor-like protein kinase At5g5970038.462%Swiss-Protweak database homology
Q9LX66Arabidopsis thalianaReceptor-like protein kinase HERK 137.870%Swiss-Protweak database homology

JBrowse

View in Genome Browser