LXL04_007476 | RubberDandelionOmics

Gene overview

LXL04_007476

Reference: OH-1004 Chr: Chr02 Coordinates: 49604315-49609166 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · LXL04_007476|LXL04_007476|OH1004|cDNA

ATGGGTAGTCTTGGTGTGTTGAGAAATACGACAATGGTGTGTGTGCCATTGATGAGGCATTCCGTCGAACAGATGGTGGGTGATATGTATCAGGCGAAGATTGATGGTGCAGACCTAGTCGAACTCAGGCTTGATTGCTTGAAGGAGTTCGACGCTCAAAGAGATCTCCAGACTCTTCTTCGCAATAAACCACTCCCGGTTGCCGTCGTCTACCGGCCAAAATGGGAGGGTGGTTTATACGATGGCGATGAAAACTCAAG...

CDS

Download CDS FASTA

1560 bp · LXL04_007476|LXL04_007476|OH1004|CDS

ATGGGTAGTCTTGGTGTGTTGAGAAATACGACAATGGTGTGTGTGCCATTGATGAGGCATTCCGTCGAACAGATGGTGGGTGATATGTATCAGGCGAAGATTGATGGTGCAGACCTAGTCGAACTCAGGCTTGATTGCTTGAAGGAGTTCGACGCTCAAAGAGATCTCCAGACTCTTCTTCGCAATAAACCACTCCCGGTTGCCGTCGTCTACCGGCCAAAATGGGAGGGTGGTTTATACGATGGCGATGAAAACTCAAG...

Protein

Download Protein FASTA

519 aa · LXL04_007476|LXL04_007476|OH1004|PROTEIN

MGSLGVLRNTTMVCVPLMRHSVEQMVGDMYQAKIDGADLVELRLDCLKEFDAQRDLQTLLRNKPLPVAVVYRPKWEGGLYDGDENSRLEALVLARDLGAEYVDFELQVASGIMEKRKLNQRSNCKIIVSCFVDGVTSLKEDLSHLLTRMQSTGADIIKLVTNATDITELSRIFHLLSHCQVPLIAYSTGERGLISQLLGPKFGGVFVYGSIEGNLVPGLPTLASLREAYGVENIDADTKVFGLISKPVSHSKGPILHNPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007476`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007476

Location Chr02:49604315-49609166 (-)

Description Similar to EMB3004: Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06350`	Bifunctional dehydroquinate dehydratase-shikimate dehydrogenase enzyme that catalyzes two steps in the chorismate biosynthesis pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007476 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0019632 shikimate metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003855 3-dehydroquinate dehydratase activity Molecular Function

GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT3G06350

bcb:BCB4264_A4454

bce:BC4331

bwe:BcerKBAB4_4185

mka:MK0117

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · LXL04_007476 · OH-1004

Nucleus0.218

Rank 2 · LXL04_007476 · OH-1004

Plastid0.214

Rank 3 · LXL04_007476 · OH-1004

Cell membrane0.074

Rank 4 · LXL04_007476 · OH-1004

Peroxisome0.072

Rank 5 · LXL04_007476 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01487.23DHquinase_I13-233 aa

PF08501.17Shikimate_dh_N243-323 aa

PF18317.7SDH_C486-516 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007476	`PF01487.23`	DHquinase_I	13	233	5.8e-57	194.0
LXL04_007476	`PF08501.17`	Shikimate_dh_N	243	323	1e-23	84.1
LXL04_007476	`PF18317.7`	SDH_C	486	516	6.6e-08	32.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQT8`	Arabidopsis thaliana	Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic	51.056%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card