LXL04_007148 | RubberDandelionOmics

Gene overview

LXL04_007148

Reference: OH-1004 Chr: Chr02 Coordinates: 37351423-37357313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3726 bp · LXL04_007148|LXL04_007148|OH1004|cDNA

ATGTCGACCTCCATGTCTAGATTGAGGACCCTTGACCTTGGGCTGGCTCCAAATCTTGAAGAGTTGGTTCTTGTTAAATGCAAGGATTTGAAAAAACTTCATTTGCCCAGAAGATGTATAAATCTAAGATGCTTACTACTCACTTATACAAAGTTGAGGACCCTTGACATTGGTTTGTCTCCGAATCTCAAGAAGTTTGATCTTCAAAATTCTTATTGTTTAGAGGAACTTCACATGAATGAATGTCAAAAGCTCACCAA...

CDS

Download CDS FASTA

3726 bp · LXL04_007148|LXL04_007148|OH1004|CDS

ATGTCGACCTCCATGTCTAGATTGAGGACCCTTGACCTTGGGCTGGCTCCAAATCTTGAAGAGTTGGTTCTTGTTAAATGCAAGGATTTGAAAAAACTTCATTTGCCCAGAAGATGTATAAATCTAAGATGCTTACTACTCACTTATACAAAGTTGAGGACCCTTGACATTGGTTTGTCTCCGAATCTCAAGAAGTTTGATCTTCAAAATTCTTATTGTTTAGAGGAACTTCACATGAATGAATGTCAAAAGCTCACCAA...

Protein

Download Protein FASTA

1241 aa · LXL04_007148|LXL04_007148|OH1004|PROTEIN

MSTSMSRLRTLDLGLAPNLEELVLVKCKDLKKLHLPRRCINLRCLLLTYTKLRTLDIGLSPNLKKFDLQNSYCLEELHMNECQKLTKLKISHSMLRTLDLGLTPNIKTLDLKECDKLIEICTPIGWRKQLVHVDLSGCLRFKSFLFQIKNNTSCSVDESIVVGPIPQLNLFVESLERCRLHPDNNLPNFRFDCVCKEDRPSFTRNLEMLFSVGMCDCTNLQKFSGSICGLQRLRSLDLRGSFLEAIKDFDRLECLEELIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007148`
TK1151 ID	TkA03G115150
OH-1004 ID	LXL04_007148
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.600
Protein coverage (%)	TK1151 47.302 / OH-1004 11.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007148

Location Chr02:37351423-37357313 (+)

Description Similar to N: TMV resistance protein N

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12010`	TIR-NB-LRR receptor-like protein involved in plant defense.	Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007148 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · LXL04_007148 · OH-1004

Nucleus0.332

Rank 2 · LXL04_007148 · OH-1004

Cell membrane0.177

Rank 3 · LXL04_007148 · OH-1004

Endoplasmic reticulum0.107

Rank 4 · LXL04_007148 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_007148 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14217-330 aa

PF13855.13LRR_8277-332 aa

PF23598.2LRR_14317-402 aa

PF25013.1LRR_Zer-1321-381 aa

PF01582.26TIR432-599 aa

PF00931.29NB-ARC611-776 aa

PF23282.2WHD_ROQ1844-919 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007148	`PF23598.2`	LRR_14	217	330	2.9e-16	59.9
LXL04_007148	`PF13855.13`	LRR_8	277	332	1.8e-09	37.9
LXL04_007148	`PF23598.2`	LRR_14	317	402	2.9e-16	59.9
LXL04_007148	`PF25013.1`	LRR_Zer-1	321	381	2.9e-10	41.1
LXL04_007148	`PF01582.26`	TIR	432	599	5.2e-19	69.4
LXL04_007148	`PF00931.29`	NB-ARC	611	776	2.1e-19	70.5
LXL04_007148	`PF23282.2`	WHD_ROQ1	844	919	3e-12	47.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ66`	Arabidopsis thaliana	Disease resistance-like protein DSC1	28.435%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card