RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_007010
Reference: OH-1004 Chr: Chr02 Coordinates: 33471968-33475239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1179 bp · LXL04_007010|LXL04_007010|OH1004|cDNA

ATGCTCCTTTCTCCCACCGACTCTCCTCCGCCGGATGCTTGTCCGCCAGTTCAGATACTCTTTTGCCGGCGCCGGTTACGGCCCATCTTCTCCAGAGGACGCCGGCGCTGTCCCTTCCGAACATTGTCGATCGATTCTTCTTCTCCAGAAACCGATTCTAATGCTTCTTTCATATTCAGATTTCTGGACTTTAGAAAAGTTGATTTCAGGTGCGATTTTCTGGCTTCATTGTGTTGTTCGCATTCATCATGGAAGCCGAG...

CDS

Download CDS FASTA

1179 bp · LXL04_007010|LXL04_007010|OH1004|CDS

ATGCTCCTTTCTCCCACCGACTCTCCTCCGCCGGATGCTTGTCCGCCAGTTCAGATACTCTTTTGCCGGCGCCGGTTACGGCCCATCTTCTCCAGAGGACGCCGGCGCTGTCCCTTCCGAACATTGTCGATCGATTCTTCTTCTCCAGAAACCGATTCTAATGCTTCTTTCATATTCAGATTTCTGGACTTTAGAAAAGTTGATTTCAGGTGCGATTTTCTGGCTTCATTGTGTTGTTCGCATTCATCATGGAAGCCGAG...

Protein

Download Protein FASTA

392 aa · LXL04_007010|LXL04_007010|OH1004|PROTEIN

MLLSPTDSPPPDACPPVQILFCRRRLRPIFSRGRRRCPFRTLSIDSSSPETDSNASFIFRFLDFRKVDFRCDFLASLCCSHSSWKPRGWISARSPVIKRKSSDVFEVKATFVSDSADESEVAPVSKSKVAETVVLGLLFGAWYLFNIYFNIYNKQVLEVFPNPITLTAIQLAVGTSIIFLTWALNLHKWPNISRAQLLYNLHIYQTLWVVTSLLPIVGGVGLASLTEVSFNCAMASNLANQSRNVLSKKVMVQKEEPLDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_007010
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_007010
LocationChr02:33471968-33475239 (+)
DescriptionSimilar to PPT2: Phosphoenolpyruvate/phosphate translocator 2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g33320 Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP), 2-phosphoglycerate, 3-phosphoglycerate and dihydroxyacetone phosphate.
The phosphoenolpyruvate/phosphate translocator is required for phenolic metabolism, palisade cell development, and plastid-dependent nuclear gene expression.1999 · DOI: 10.1105/tpc.11.9.1609
The phenotype of the Arabidopsis cue1 mutant is not simply caused by a general restriction of the shikimate pathway.2003 · DOI: 10.1046/j.1365-313x.2003.01889.x
Characterization of two functional phosphoenolpyruvate/phosphate translocator (PPT) genes in Arabidopsis--AtPPT1 may be involved in the provision of signals for correct mesophyll development.2003 · DOI: 10.1046/j.1365-313x.2003.01888.x

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0344600 Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate. No verified direct reference in this release
Os09g0297400 Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate. No verified direct reference in this release
Os01g0172100 Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007010 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0015713 phosphoglycerate transmembrane transport Biological Process
GO:0015714 phosphoenolpyruvate transport Biological Process
GO:0035436 triose phosphate transmembrane transport Biological Process
GO:0005794 Golgi apparatus Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009528 plastid inner membrane Cellular Component
GO:0009536 plastid Cellular Component
GO:0009941 chloroplast envelope Cellular Component
GO:0031969 chloroplast membrane Cellular Component
GO:0009670 triose-phosphate:phosphate antiporter activity Molecular Function
GO:0015120 phosphoglycerate transmembrane transporter activity Molecular Function
GO:0015121 phosphoenolpyruvate:phosphate antiporter activity Molecular Function
KEGG gene cross-reference
ath:AT5G33320
dosa:Os01g0172100
dosa:Os08g0344600
dosa:Os09g0297400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.946
Rank 1 · LXL04_007010 · OH-1004
Endoplasmic reticulum0.063
Rank 2 · LXL04_007010 · OH-1004
Golgi apparatus0.028
Rank 3 · LXL04_007010 · OH-1004
Nucleus0.026
Rank 4 · LXL04_007010 · OH-1004
Peroxisome0.026
Rank 5 · LXL04_007010 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151.23TPT134-198 aa
PF03151.23TPT204-365 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_007010PF03151.23TPT1341981.2e-75255.3
LXL04_007010PF03151.23TPT2043651.2e-75255.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8RXN3Arabidopsis thalianaPhosphoenolpyruvate/phosphate translocator 1, chloroplastic48.680%Swiss-Protmoderate database homology
Q84QU8Oryza sativa subsp. japonicaPhosphoenolpyruvate/phosphate translocator 2, chloroplastic53.503%Swiss-Protmoderate database homology
Q69VR7Oryza sativa subsp. japonicaPhosphoenolpyruvate/phosphate translocator 1, chloroplastic55.743%Swiss-Protmoderate database homology
Q5VQL3Oryza sativa subsp. japonicaPhosphoenolpyruvate/phosphate translocator 3, chloroplastic49.026%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser