LXL04_005987 | RubberDandelionOmics

Gene overview

LXL04_005987

Reference: OH-1004 Chr: Chr01 Coordinates: 176688265-176688947 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

561 bp · LXL04_005987|LXL04_005987|OH1004|cDNA

ATGCTTCAATTGGATCCATACTCTACAACCACTGTTTATAAGGACACTAGTCCGGCGGGAACGTTTTGTTACATGGATCCAGAGTATCAACGAACGGGACTCGTTTCTCCAAAATCAGACGTTTATGCTCTGGGTATGGTGATTTTGCAGTTGTTGATAGCAAAACCGGCGATAGGACTAACCGATGCTGTGGAAACCGCTATCGAAGATGAGGAGTTAGCCATGGTGCTCGATCCAGAAGCAGGGGAGTGGTCGGTTGA...

CDS

Download CDS FASTA

561 bp · LXL04_005987|LXL04_005987|OH1004|CDS

ATGCTTCAATTGGATCCATACTCTACAACCACTGTTTATAAGGACACTAGTCCGGCGGGAACGTTTTGTTACATGGATCCAGAGTATCAACGAACGGGACTCGTTTCTCCAAAATCAGACGTTTATGCTCTGGGTATGGTGATTTTGCAGTTGTTGATAGCAAAACCGGCGATAGGACTAACCGATGCTGTGGAAACCGCTATCGAAGATGAGGAGTTAGCCATGGTGCTCGATCCAGAAGCAGGGGAGTGGTCGGTTGA...

Protein

Download Protein FASTA

186 aa · LXL04_005987|LXL04_005987|OH1004|PROTEIN

MLQLDPYSTTTVYKDTSPAGTFCYMDPEYQRTGLVSPKSDVYALGMVILQLLIAKPAIGLTDAVETAIEDEELAMVLDPEAGEWSVDEAKELAALGLSCTELHRRDRPDLKDTVLPVLERLKAVAGEAQRIASTKRATPPNHFICPILKVLTKSQGTVIIEIDEDDPYLDPAWPHLQLEYVAIGKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005987`
TK1151 ID	TkA01G002840
OH-1004 ID	LXL04_005987
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005987

Location Chr01:176688265-176688947 (+)

Description Similar to PUB52: U-box domain-containing protein 52

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61550`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At4g25160`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g51270`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g61560`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g19410`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19410

ath:AT4G25160

ath:AT5G61550

ath:AT5G61560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.407

Rank 1 · LXL04_005987 · OH-1004

Cytoplasm0.375

Rank 2 · LXL04_005987 · OH-1004

Nucleus0.300

Rank 3 · LXL04_005987 · OH-1004

Endoplasmic reticulum0.068

Rank 4 · LXL04_005987 · OH-1004

Golgi apparatus0.047

Rank 5 · LXL04_005987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKG6`	Arabidopsis thaliana	U-box domain-containing protein 52	59.333%	Swiss-Prot	strong database homology
`Q9SW11`	Arabidopsis thaliana	U-box domain-containing protein 35	58.278%	Swiss-Prot	strong database homology
`Q9LU47`	Arabidopsis thaliana	Putative U-box domain-containing protein 53	58.170%	Swiss-Prot	strong database homology
`Q9FKG5`	Arabidopsis thaliana	U-box domain-containing protein 51	48.387%	Swiss-Prot	moderate database homology
`Q8S8S7`	Arabidopsis thaliana	U-box domain-containing protein 34	46.479%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card