LXL04_005972 | RubberDandelionOmics

Gene overview

LXL04_005972

Reference: OH-1004 Chr: Chr01 Coordinates: 176510793-176511783 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · LXL04_005972|LXL04_005972|OH1004|cDNA

ATGGCGTGGTCGATTCGCGCTTTTGCTCAAGGTTACAGAGTTTTGATGGCGGCTGCCAACAgcgccaccaccgccaccgccgtTGCACCCAAGCGTGGCCGCCCCGCCGGTATTCTCAAAGTAGTTCCAGTATCACAATCTCTTGGTGAGTTCCTCGGCGTATCTGAAGCCTCTCGAACCGACGCAGTGAAGAAAGTATGGGGATACATCAAGGACAATAACCTCCAGAACCCTTTAAACAAGAAGGAGATCCTGTGTGA...

CDS

Download CDS FASTA

354 bp · LXL04_005972|LXL04_005972|OH1004|CDS

ATGGCGTGGTCGATTCGCGCTTTTGCTCAAGGTTACAGAGTTTTGATGGCGGCTGCCAACAGCGCCACCACCGCCACCGCCGTTGCACCCAAGCGTGGCCGCCCCGCCGGTATTCTCAAAGTAGTTCCAGTATCACAATCTCTTGGTGAGTTCCTCGGCGTATCTGAAGCCTCTCGAACCGACGCAGTGAAGAAAGTATGGGGATACATCAAGGACAATAACCTCCAGAACCCTTTAAACAAGAAGGAGATCCTGTGTGA...

Protein

Download Protein FASTA

117 aa · LXL04_005972|LXL04_005972|OH1004|PROTEIN

MAWSIRAFAQGYRVLMAAANSATTATAVAPKRGRPAGILKVVPVSQSLGEFLGVSEASRTDAVKKVWGYIKDNNLQNPLNKKEILCDAKLKSIFNGKDQVGFLEIAKLLSQHFVKST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005972`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005972

Location Chr01:176510793-176511783 (+)

Description Similar to UAF30: Upstream activation factor subunit UAF30 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51120`	Zinc finger CCCH domain-containing protein 44.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005972 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006361 transcription initiation at RNA polymerase I promoter Biological Process

GO:0042790 nucleolar large rRNA transcription by RNA polymerase I Biological Process

GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process

GO:0000500 RNA polymerase I upstream activating factor complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0001165 RNA polymerase I cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001181 RNA polymerase I general transcription initiation factor activity Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

sce:YMR233W

sce:YOR295W

spo:2539310

vg:4156281

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.809

Rank 1 · LXL04_005972 · OH-1004

Plastid0.135

Rank 2 · LXL04_005972 · OH-1004

Nucleus0.048

Rank 3 · LXL04_005972 · OH-1004

Cytoplasm0.042

Rank 4 · LXL04_005972 · OH-1004

Extracellular0.009

Rank 5 · LXL04_005972 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02201.24SWIB41-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005972	`PF02201.24`	SWIB	41	113	4.5e-30	103.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD34`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 44	36.264%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card