LXL04_005094 | RubberDandelionOmics

Gene overview

LXL04_005094

Reference: OH-1004 Chr: Chr01 Coordinates: 154400705-154420995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

9102 bp · LXL04_005094|LXL04_005094|OH1004|cDNA

ATGGCATCAAGTTCTGGAAACTCGCTTCCTGCTCCCGAGGCGATTCAGGTTCTGGTTTCATCGCTCGCTGATGAATCCCCAATGGTTAAGCAAGCGTCCATGGCGTCTCTTAAAGCCCTCGCTCCTTTGAACCCACTTTTAGTTCTTGATTGTTGCTTAACGGTATCTCGAGGCGGCCGTCGGAGGTTTGGGAATATTGCTGGTGTATTTCAAGTAATGTCGATTGCAATTAGTGCCCTTGAAGAAGGGGAAGTAGACAC...

CDS

Download CDS FASTA

9102 bp · LXL04_005094|LXL04_005094|OH1004|CDS

ATGGCATCAAGTTCTGGAAACTCGCTTCCTGCTCCCGAGGCGATTCAGGTTCTGGTTTCATCGCTCGCTGATGAATCCCCAATGGTTAAGCAAGCGTCCATGGCGTCTCTTAAAGCCCTCGCTCCTTTGAACCCACTTTTAGTTCTTGATTGTTGCTTAACGGTATCTCGAGGCGGCCGTCGGAGGTTTGGGAATATTGCTGGTGTATTTCAAGTAATGTCGATTGCAATTAGTGCCCTTGAAGAAGGGGAAGTAGACAC...

Protein

Download Protein FASTA

3033 aa · LXL04_005094|LXL04_005094|OH1004|PROTEIN

MASSSGNSLPAPEAIQVLVSSLADESPMVKQASMASLKALAPLNPLLVLDCCLTVSRGGRRRFGNIAGVFQVMSIAISALEEGEVDTSYMTKLAKLATAEIISSKEIKADWQRAASSLLVAIGSHLPDLMMEELFLHLSAQNTALPAMVQILADFATSDALQFTPRLKGVLSRVLPILGNVKDQHRPIFANAFRCWCQACWQYSVEYPLSSILDSDVMSFLNSAFELLLQNWATSRDLKVRTSAVEALGQLVGLVTRTLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005094`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005094

Location Chr01:154400705-154420995 (-)

Description Similar to SGR6: Protein SHOOT GRAVITROPISM 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36810`	Involved in inflorescence stems gravitropism, by modulating vacuolar membrane (VMs) dynamics in gravity-sensing cells (e.g. endodermal cells) during the amyloplast sedimentation process.	A unique HEAT repeat-containing protein SHOOT GRAVITROPISM6 is involved in vacuolar membrane dynamics in gravity-sensing cells of Arabidopsis inflorescence stem.2014 · DOI: 10.1093/pcp/pcu020 Mutations in the SGR4, SGR5 and SGR6 loci of Arabidopsis thaliana alter the shoot gravitropism.1997 · DOI: 10.1093/oxfordjournals.pcp.a029201

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005094 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009660 amyloplast organization Biological Process

GO:0009959 negative gravitropism Biological Process

GO:0016134 saponin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AFN26667

ath:AT2G36810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · LXL04_005094 · OH-1004

Nucleus0.278

Rank 2 · LXL04_005094 · OH-1004

Cell membrane0.117

Rank 3 · LXL04_005094 · OH-1004

Golgi apparatus0.113

Rank 4 · LXL04_005094 · OH-1004

Endoplasmic reticulum0.098

Rank 5 · LXL04_005094 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23221.2HEAT_MROH2B_1st44-251 aa

PF23210.2HEAT_Maestro_2260-908 aa

PF21047.4HEAT_Maestro1026-1200 aa

PF26767.1HEAT_SGR61238-1416 aa

PF24714.2TOR1L1_N1400-1578 aa

PF13513.13HEAT_EZ1401-1452 aa

PF25786.1HEAT_GCN1_C1401-1502 aa

PF12717.14Cnd11422-1513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005094	`PF23221.2`	HEAT_MROH2B_1st	44	251	4.8e-33	115.4
LXL04_005094	`PF23210.2`	HEAT_Maestro_2	260	908	4.9e-94	316.6
LXL04_005094	`PF21047.4`	HEAT_Maestro	1026	1200	2.6e-07	31.5
LXL04_005094	`PF26767.1`	HEAT_SGR6	1238	1416	3.1e-82	275.5
LXL04_005094	`PF24714.2`	TOR1L1_N	1400	1578	1e-10	42.1
LXL04_005094	`PF13513.13`	HEAT_EZ	1401	1452	3.2e-11	44.2
LXL04_005094	`PF25786.1`	HEAT_GCN1_C	1401	1502	5.5e-11	43.4
LXL04_005094	`PF12717.14`	Cnd1	1422	1513	1.1e-08	36.1
LXL04_005094	`PF23227.2`	HEAT_MROH2B_C	1428	1695	2.8e-70	237.5
LXL04_005094	`PF26168.1`	Glyco_transf_N	1745	1988	1.9e-13	51.5
LXL04_005094	`PF00201.25`	UDPGT	2023	2136	1.5e-34	120.4
LXL04_005094	`PF23227.2`	HEAT_MROH2B_C	2364	2555	2.8e-70	237.5
LXL04_005094	`PF26168.1`	Glyco_transf_N	2551	2794	1.9e-13	51.5
LXL04_005094	`PF00201.25`	UDPGT	2829	2942	1.5e-34	120.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IP13`	Arabidopsis thaliana	Protein SHOOT GRAVITROPISM 6	68.460%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card