LXL04_004367 | RubberDandelionOmics

Gene overview

LXL04_004367

Reference: OH-1004 Chr: Chr01 Coordinates: 133704036-133706435 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1740 bp · LXL04_004367|LXL04_004367|OH1004|cDNA

ATGGCTTCAAACAATGTCCCCATGGAGATCTCCATAATTTCTGAAGAACGAGCACCGATTCATCACAATCGCAAACCAAAACGAAAAGTAGGAGGATGGACTCCAGCGTTTCTCCTTCTCGTGAATCAAGCTCTGGCGACCTTTGCATTCTTCGGAGTTGGAGTGAACATGGTGCTGTTTTTGACGAGAGTGATTGATCAAGACAATGCAGATGCAGCCAATAGCGTTAGCAAATGGACGGGCACCGTTTATTTGTGTTC...

CDS

Download CDS FASTA

1740 bp · LXL04_004367|LXL04_004367|OH1004|CDS

ATGGCTTCAAACAATGTCCCCATGGAGATCTCCATAATTTCTGAAGAACGAGCACCGATTCATCACAATCGCAAACCAAAACGAAAAGTAGGAGGATGGACTCCAGCGTTTCTCCTTCTCGTGAATCAAGCTCTGGCGACCTTTGCATTCTTCGGAGTTGGAGTGAACATGGTGCTGTTTTTGACGAGAGTGATTGATCAAGACAATGCAGATGCAGCCAATAGCGTTAGCAAATGGACGGGCACCGTTTATTTGTGTTC...

Protein

Download Protein FASTA

579 aa · LXL04_004367|LXL04_004367|OH1004|PROTEIN

MASNNVPMEISIISEERAPIHHNRKPKRKVGGWTPAFLLLVNQALATFAFFGVGVNMVLFLTRVIDQDNADAANSVSKWTGTVYLCSLLGAFLSDSYWGRYLTCAIFQLILVMGLVLLSLTSWLFLVKPFGCGDGVNHCFPTSTKGTMMFYLSIYMIALGYGGHQPTLATLGSDQFDDSDPKHRHKGSKAAFFAYFYAALNIGSLFSNSILVYYEDIGHWTTGFWVSMVAAVVALLLFFCGSFHYRYVKASGNPLPRVGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004367`
TK1151 ID	TkA01G164430
OH-1004 ID	LXL04_004367
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004367

Location Chr01:133704036-133706435 (-)

Description Similar to NPF7.1: Protein NRT1/ PTR FAMILY 7.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19640`	Protein NRT1/ PTR FAMILY 7.1.	No verified direct reference in this release
`At1g32450`	Low-affinity proton-dependent bidirectional nitrate transporter.	Mutation of the Arabidopsis NRT1.5 nitrate transporter causes defective root-to-shoot nitrate transport.2008 · DOI: 10.1105/tpc.108.060244
`At4g21680`	Low-affinity nitrate transporter.	The Arabidopsis nitrate transporter NRT1.8 functions in nitrate removal from the xylem sap and mediates cadmium tolerance.2010 · DOI: 10.1105/tpc.110.075242
`At3g54140`	Peptide transporter.	AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02224.x AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At2g02040`	Peptide transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004367 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010150 leaf senescence Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015031 protein transport Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0015833 peptide transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0042938 dipeptide transport Biological Process

GO:0042939 tripeptide transport Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1902600 proton transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G32450

ath:AT2G02040

ath:AT3G54140

ath:AT4G21680

ath:AT5G19640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.661

Rank 1 · LXL04_004367 · OH-1004

Lysosome / Vacuole0.145

Rank 2 · LXL04_004367 · OH-1004

Endoplasmic reticulum0.084

Rank 3 · LXL04_004367 · OH-1004

Cytoplasm0.081

Rank 4 · LXL04_004367 · OH-1004

Golgi apparatus0.042

Rank 5 · LXL04_004367 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690.22MFS_118-176 aa

PF00854.28PTR2102-528 aa

PF07690.22MFS_1190-505 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004367	`PF07690.22`	MFS_1	18	176	1.6e-13	51.0
LXL04_004367	`PF00854.28`	PTR2	102	528	5.8e-91	306.0
LXL04_004367	`PF07690.22`	MFS_1	190	505	1.6e-13	51.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E9B5`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 7.1	66.790%	Swiss-Prot	strong database homology
`Q9LQL2`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 7.3	60.541%	Swiss-Prot	strong database homology
`Q8GXN2`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 7.2	58.897%	Swiss-Prot	strong database homology
`Q9M390`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 8.1	44.765%	Swiss-Prot	moderate database homology
`P46032`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 8.3	41.593%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card