LXL04_002522 | RubberDandelionOmics

Gene overview

LXL04_002522

Reference: OH-1004 Chr: Chr01 Coordinates: 50749789-50752439 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2565 bp · LXL04_002522|LXL04_002522|OH1004|cDNA

ATGGCACTCAAACTCCTAATCTTCATGTTCCCTATGTTAATTGCATCTTGCGTTCTAGCTGAGATGAAGATTTATTGCACGCCAGAAGATGAAGTTGCTCCAAAAATAAAAGACGGTGATAAGAAAGAATGTCCGAATCCGAAAGGTGGCGGCAGCGGCGATAAGAAAGACGGCGGTGGCGGGAAAGACCGCCCGAATCCAAAAGGCGATGGCGGTGACGCTGCTCCTAAAGGAGGCGACGGTGGTAAAGACTGTCCTGA...

CDS

Download CDS FASTA

2565 bp · LXL04_002522|LXL04_002522|OH1004|CDS

ATGGCACTCAAACTCCTAATCTTCATGTTCCCTATGTTAATTGCATCTTGCGTTCTAGCTGAGATGAAGATTTATTGCACGCCAGAAGATGAAGTTGCTCCAAAAATAAAAGACGGTGATAAGAAAGAATGTCCGAATCCGAAAGGTGGCGGCAGCGGCGATAAGAAAGACGGCGGTGGCGGGAAAGACCGCCCGAATCCAAAAGGCGATGGCGGTGACGCTGCTCCTAAAGGAGGCGACGGTGGTAAAGACTGTCCTGA...

Protein

Download Protein FASTA

854 aa · LXL04_002522|LXL04_002522|OH1004|PROTEIN

MALKLLIFMFPMLIASCVLAEMKIYCTPEDEVAPKIKDGDKKECPNPKGGGSGDKKDGGGGKDRPNPKGDGGDAAPKGGDGGKDCPDPKGAGGDCAPPSCPDPKAADGGGAAPNGGSDGKDCPYPKGADGNNVTPKGGGDDKDCPDPKGASGGNLPPPCPDPKGANGGVAAPPYPNPKGAHGGDAAPKGGGDGKDCPVPKDANEGGVAPPCPDPKVAGGGCIPPPCPKPKGAEGSGANPKGGGDGKYCPDPKGAGGGGGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002522`
TK1151 ID	TkA01G459190
OH-1004 ID	LXL04_002522
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.500
Protein coverage (%)	TK1151 84.885 / OH-1004 73.653 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002522

Location Chr01:50749789-50752439 (-)

Description Similar to Putative aldehyde oxidase Art an 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67290`	Catalyzes the oxidation of aldehydes to the corresponding carboxylate by coupling the reaction to the reduction of dioxygen to hydrogen peroxide.	The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana.2011 · DOI: 10.1105/tpc.110.082651

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002522 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0050665 hydrogen peroxide biosynthetic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004031 aldehyde oxidase activity Molecular Function

KEGG gene cross-reference

abe:ARB_07867

ag:AAA33747

ath:AT1G67290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.836

Rank 1 · LXL04_002522 · OH-1004

Cytoplasm0.067

Rank 2 · LXL04_002522 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_002522 · OH-1004

Endoplasmic reticulum0.043

Rank 4 · LXL04_002522 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_002522 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07250.18Glyoxal_oxid_N338-741 aa

PF09118.18GO-like_E_set750-852 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002522	`PF07250.18`	Glyoxal_oxid_N	338	741	2e-133	445.5
LXL04_002522	`PF09118.18`	GO-like_E_set	750	852	2.4e-23	83.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYG4`	Arabidopsis thaliana	Aldehyde oxidase GLOX1	43.068%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card