Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1786 bp · LXL04_002150|LXL04_002150|OH1004|cDNA
TGACAAAAGGATTATaccaaactttttttttttttgcaattaGTTACCCGCTTTGGGAAACTAAATCCTCTGCAATGCAGGCGATTACAGGTTCTGGAACCAACACCTCCCCTTCATCCAACGAGCGAGCACCTTCTCCTCCGCATCATCATCAAAGTCAACGCCATCCAACGGCGGAGAAAGGCGGTTTGACTACATCGTCGTTGGAGGTGGCACCGCAGGGTGTCCATTGGCAGCCACACTGTCACAAAACTACAGCG...
1557 bp · LXL04_002150|LXL04_002150|OH1004|CDS
TTGGCAGCCACACTGTCACAAAACTACAGCGTTTTATTACTAGAAAGAGGAGGTGTCCCTTTTGGCAACATAAATGTGTCGTTTATGTCAAATTTCCATCTTACCCTTGTGGACACGTCACCTGCTTCTGCTTCTCAGTATTTCGTATCCACCGATGGGGTTTTTAATGCGAGGGCTAGAGTGTTGGGTGGTGGTACTTCCATTAATGCCGGCTTTTACACTCGGGCAAGCACAAGATATGTTAAACGGGTCGGATGGGA...
Protein
Download Protein FASTA518 aa · LXL04_002150|LXL04_002150|OH1004|PROTEIN
MAATLSQNYSVLLLERGGVPFGNINVSFMSNFHLTLVDTSPASASQYFVSTDGVFNARARVLGGGTSINAGFYTRASTRYVKRVGWDAKLVNESYPWVEKQIVHEPVFEPWQRAVRDGLLEVGISPDNGFTYDHMYGTKVGGTIFDKYGRRHTAAELLSSGNQQNLTVLIHARVQKIIFDTTGKKPRAIGVIFKDENGVDHEAFISRRRRSEIIISCGAIGSPHMLLLSGIGPKEDLEKLNISVVHDNKFVGKHMSDNPL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002150 |
|---|---|
| TK1151 ID | TkA01G478770 |
| OH-1004 ID | LXL04_002150 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 86.913 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002150 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:42773784-42777670 (+) | |||||||||
| Description | Similar to HTH: Protein HOTHEAD | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007267 cell-cell signaling Biological Process GO:0009553 embryo sac development Biological Process GO:0010430 fatty acid omega-oxidation Biological Process GO:0046202 cyanide biosynthetic process Biological Process GO:0005576 extracellular region Cellular Component GO:0033095 aleurone grain Cellular Component GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Molecular Function GO:0046593 mandelonitrile lyase activity Molecular Function GO:0050660 flavin adenine dinucleotide binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G72970 ath:AT1G73050 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00732.26GMC_oxred_N55-258 aaPF05199.20GMC_oxred_C355-500 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002150 | PF00732.26 | GMC_oxred_N | 55 | 258 | 6.5e-21 | 75.9 |
| LXL04_002150 | PF05199.20 | GMC_oxred_C | 355 | 500 | 2.7e-28 | 100.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.