LXL04_002006 | RubberDandelionOmics

Gene overview

LXL04_002006

Reference: OH-1004 Chr: Chr01 Coordinates: 39417896-39419218 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1244 bp · LXL04_002006|LXL04_002006|OH1004|cDNA

ATGGAGATTGAACAGCATTTAAAGCCGATGAAGCCTAAGATCGAGGAAGAGGAACCAAAAGACGCCTACCAGATCGCATACATTATCCATTTCTTACTCGGTGCCGGCTACTTAGTTCCATGGAACGCCTTCATCACCGCCGTCGACTACTTCCAGTACCTCTACCCCTCCAAACACATCAACAAGGTTTTCTCCGTTGGTTACATGAGCGCCGCCGTGACGGTGCTTCTCACCCTCCTCTGTTGGTCCAAATCAAGCCG...

CDS

Download CDS FASTA

1233 bp · LXL04_002006|LXL04_002006|OH1004|CDS

ATGGAGATTGAACAGCATTTAAAGCCGATGAAGCCTAAGATCGAGGAAGAGGAACCAAAAGACGCCTACCAGATCGCATACATTATCCATTTCTTACTCGGTGCCGGCTACTTAGTTCCATGGAACGCCTTCATCACCGCCGTCGACTACTTCCAGTACCTCTACCCCTCCAAACACATCAACAAGGTTTTCTCCGTTGGTTACATGAGCGCCGCCGTGACGGTGCTTCTCACCCTCCTCTGTTGGTCCAAATCAAGCCG...

Protein

Download Protein FASTA

410 aa · LXL04_002006|LXL04_002006|OH1004|PROTEIN

MEIEQHLKPMKPKIEEEEPKDAYQIAYIIHFLLGAGYLVPWNAFITAVDYFQYLYPSKHINKVFSVGYMSAAVTVLLTLLCWSKSSRIQLPSVRTRMNVGQALFISALMVAPVTDWIDHGNQTANGSNVAFVVLVSMVMISGLADGLVGGSLVGATGELPGRYMQAVFAGNATAGLMVSILRVITKASLPHTQKGLRTSTQIYFVFSALIVLACVICTNVLDKLPVIRYYRNRARNDPTGAHVPIGTHFWVVVKKIRWFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002006`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002006

Location Chr01:39417896-39419218 (-)

Description Similar to ETN8: Equilibrative nucleotide transporter 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02630`	May be involved in nucleoside transport.	No verified direct reference in this release
`At1g70330`	Nucleoside transporter involved in adenosine transport and required for nucleotide metabolism which influences growth and pollen germination.	Characterisation of a concentrative type of adenosine transporter from Arabidopsis thaliana (ENT1,At).2001 · DOI: 10.1016/s0014-5793(01)03195-7 Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389 Equilibrative nucleoside transporter 1 (ENT1) is critical for pollen germination and vegetative growth in Arabidopsis.2011 · DOI: 10.1093/jxb/err183
`At1g61630`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At4g05130`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At4g05120`	Nucleoside transporter that functions as a pyrimidine nucleoside carrier in all organs.	Equilibrative nucleoside transporters of Arabidopsis thaliana. cDNA cloning, expression pattern, and analysis of transport activities.2003 · DOI: 10.1074/jbc.m304768200 Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389 The fluorouridine insensitive 1 (fur1) mutant is defective in equilibrative nucleoside transporter 3 (ENT3), and thus represents an important pyrimidine nucleoside uptake system in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2006.02998.x Nucleoside transport across the plasma membrane mediated by equilibrative nucleoside transporter 3 influences metabolism of Arabidopsis seedlings.2012 · DOI: 10.1111/j.1438-8677.2012.00562.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015858 nucleoside transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005337 nucleoside transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G02630

ath:AT1G61630

ath:AT1G70330

ath:AT4G05120

ath:AT4G05130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.672

Rank 1 · LXL04_002006 · OH-1004

Lysosome / Vacuole0.126

Rank 2 · LXL04_002006 · OH-1004

Cytoplasm0.120

Rank 3 · LXL04_002006 · OH-1004

Endoplasmic reticulum0.097

Rank 4 · LXL04_002006 · OH-1004

Golgi apparatus0.057

Rank 5 · LXL04_002006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01733.25Nucleoside_tran137-234 aa

PF01733.25Nucleoside_tran246-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002006	`PF01733.25`	Nucleoside_tran	137	234	3.7e-58	198.1
LXL04_002006	`PF01733.25`	Nucleoside_tran	246	408	3.7e-58	198.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84XI3`	Arabidopsis thaliana	Equilibrative nucleotide transporter 8	51.134%	Swiss-Prot	strong database homology
`Q8VXY7`	Arabidopsis thaliana	Equilibrative nucleotide transporter 1	44.638%	Swiss-Prot	moderate database homology
`Q944P0`	Arabidopsis thaliana	Equilibrative nucleotide transporter 7	31.280%	Swiss-Prot	moderate database homology
`Q9M0Y2`	Arabidopsis thaliana	Equilibrative nucleotide transporter 4	29.742%	Swiss-Prot	weak database homology
`Q9M0Y3`	Arabidopsis thaliana	Equilibrative nucleotide transporter 3	27.907%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card