Gene Card
Gene overview
cDNA / CDS / Protein Sequences
981 bp · LXL04_001947|LXL04_001947|OH1004|cDNA
atgagaaaaaaaaAAGGACAGTTATATATATCAAATAAGAATTTGGATGtaaatttaaaagaaaaattagATACAGCTCTGAACATCAACCAGTTGAAGAAAAGCGGCCGTCGGTCCCAAATATCCGATGAAAAATCCGAAGCAACTCAACCCCAACTGGGCGCAGCTCCGTCAAGTACCTTTCTTTCACTTTGTTCACGCACAACATGCACACCCATCGTTTTTTCGCTTCATCTCTCTCATGAACTTGGTTGTCTGCA...
981 bp · LXL04_001947|LXL04_001947|OH1004|CDS
ATGAGAAAAAAAAAAGGACAGTTATATATATCAAATAAGAATTTGGATGTAAATTTAAAAGAAAAATTAGATACAGCTCTGAACATCAACCAGTTGAAGAAAAGCGGCCGTCGGTCCCAAATATCCGATGAAAAATCCGAAGCAACTCAACCCCAACTGGGCGCAGCTCCGTCAAGTACCTTTCTTTCACTTTGTTCACGCACAACATGCACACCCATCGTTTTTTCGCTTCATCTCTCTCATGAACTTGGTTGTCTGCA...
Protein
Download Protein FASTA326 aa · LXL04_001947|LXL04_001947|OH1004|PROTEIN
MRKKKGQLYISNKNLDVNLKEKLDTALNINQLKKSGRRSQISDEKSEATQPQLGAAPSSTFLSLCSRTTCTPIVFSLHLSHELGCLQKLGYSSELSSKRSGTDTQETILGKRKERFDNDEVSECGVNVLAPTSSDSSITDLIAMDCEMVGVSPLGNKSALGRVTLVNKFGNVIYDEHVRPVERVVDFRTQVSGIRPRDLKKAKDFRIVQKEVAELLKGRILVGHALRNDLKALLLSHPKQDIRDTAEYQPYLKEGRKKAL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_001947 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_001947 |
|---|---|
| Location | Chr01:37806608-37808722 (+) |
| Description | Similar to Rexo4: RNA exonuclease 4 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000027 ribosomal large subunit assembly Biological Process GO:0006281 DNA repair Biological Process GO:0006308 DNA catabolic process Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003690 double-stranded DNA binding Molecular Function |
| KEGG gene cross-reference | hsa:57109 mmu:227656 sce:YOL080C xla:379197 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00929.32RNase_T142-290 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_001947 | PF00929.32 | RNase_T | 142 | 290 | 1.2e-16 | 62.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.