LXL04_001858 | RubberDandelionOmics

Gene overview

LXL04_001858

Reference: OH-1004 Chr: Chr01 Coordinates: 35173601-35175362 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · LXL04_001858|LXL04_001858|OH1004|cDNA

ATGAATGACGTACATTTGTTATTAACAGCTACGATTCTTGCAGGAATTGATTTCAATTTGAATGTTGATGGAGGTTCAATTGGAGTCAACTATGGTCGAATTGCCGGCGATCTACCATCTGCTTCCAAAGTTGTGAAGCTTCTCAAATCTCAAGGAATCAGTAGGGTTAAGGTTTACGATACTGATCCGGCTGTGCTCAGATCATTGTCCGGGAGTGGCATTAAAGTGACGGTGAACCTCCCCAACGAGCTCCTATACGC...

CDS

Download CDS FASTA

1413 bp · LXL04_001858|LXL04_001858|OH1004|CDS

ATGAATGACGTACATTTGTTATTAACAGCTACGATTCTTGCAGGAATTGATTTCAATTTGAATGTTGATGGAGGTTCAATTGGAGTCAACTATGGTCGAATTGCCGGCGATCTACCATCTGCTTCCAAAGTTGTGAAGCTTCTCAAATCTCAAGGAATCAGTAGGGTTAAGGTTTACGATACTGATCCGGCTGTGCTCAGATCATTGTCCGGGAGTGGCATTAAAGTGACGGTGAACCTCCCCAACGAGCTCCTATACGC...

Protein

Download Protein FASTA

470 aa · LXL04_001858|LXL04_001858|OH1004|PROTEIN

MNDVHLLLTATILAGIDFNLNVDGGSIGVNYGRIAGDLPSASKVVKLLKSQGISRVKVYDTDPAVLRSLSGSGIKVTVNLPNELLYAASRRQSFAYKWVQRNVMAYYPHTQIEAIAVGNEVFVDPKNTTGFLITAIKNIHQALVKFKLDSDIKLSSPVALSALQNSYPSSAGSFRPELIESVFKPMLQFLRETGSYLMVNAYPFFAYESNSDVISLDYSLFRENPGNPDAGNGLRYFNLFDAQIDAVFAAMSALKYDDIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001858`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001858

Location Chr01:35173601-35175362 (-)

Description Similar to At2g01630: Glucan endo-1,3-beta-glucosidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01630`	Glucan endo-1,3-beta-glucosidase 3.	No verified direct reference in this release
`At1g66250`	Glucan endo-1,3-beta-glucosidase 2.	No verified direct reference in this release
`At5g56590`	Glucan endo-1,3-beta-glucosidase 13.	No verified direct reference in this release
`At1g11820`	Glucan endo-1,3-beta-glucosidase 1.	No verified direct reference in this release
`At3g13560`	Glucan endo-1,3-beta-glucosidase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001858 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G11820

ath:AT1G66250

ath:AT2G01630

ath:AT3G13560

ath:AT5G56590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.381

Rank 1 · LXL04_001858 · OH-1004

Cell membrane0.221

Rank 2 · LXL04_001858 · OH-1004

Endoplasmic reticulum0.104

Rank 3 · LXL04_001858 · OH-1004

Lysosome / Vacuole0.100

Rank 4 · LXL04_001858 · OH-1004

Cytoplasm0.084

Rank 5 · LXL04_001858 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332.25Glyco_hydro_1727-346 aa

PF29664.1BtgE-BtgC_glyc-hydro44-329 aa

PF07983.19X8381-452 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001858	`PF00332.25`	Glyco_hydro_17	27	346	2.8e-88	297.2
LXL04_001858	`PF29664.1`	BtgE-BtgC_glyc-hydro	44	329	1.8e-16	60.8
LXL04_001858	`PF07983.19`	X8	381	452	7.2e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU91`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 3	41.441%	Swiss-Prot	moderate database homology
`Q9C7U5`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 2	41.163%	Swiss-Prot	moderate database homology
`Q9FJU9`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 13	40.848%	Swiss-Prot	moderate database homology
`O65399`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 1	39.910%	Swiss-Prot	moderate database homology
`Q94CD8`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 4	39.955%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card