LXL04_001715 | RubberDandelionOmics

Gene overview

LXL04_001715

Reference: OH-1004 Chr: Chr01 Coordinates: 31978600-31981071 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · LXL04_001715|LXL04_001715|OH1004|cDNA

ATGAATCCCGAATCGAGCTCCGGCGGCCACTGCCCCAGTTTTATGTTCAATTCTCTGCCACCCCAACAACAGTTCTCAAGTTTAATCGCTAACCACCCCATTTCCGGCATCGTTAAACCCGACCCAGGGTGGCCGGAGTTTTCCGTTTACGGTGGTCAGTTGGGTAATGGGTATTTGAATCAGAACACACCAGGAGTCGCCGATCAGACATTTACACCGGCGAATTCGGCTACGGTGTCACCTAAGAAAAGGAAAGCCGA...

CDS

Download CDS FASTA

1047 bp · LXL04_001715|LXL04_001715|OH1004|CDS

ATGAATCCCGAATCGAGCTCCGGCGGCCACTGCCCCAGTTTTATGTTCAATTCTCTGCCACCCCAACAACAGTTCTCAAGTTTAATCGCTAACCACCCCATTTCCGGCATCGTTAAACCCGACCCAGGGTGGCCGGAGTTTTCCGTTTACGGTGGTCAGTTGGGTAATGGGTATTTGAATCAGAACACACCAGGAGTCGCCGATCAGACATTTACACCGGCGAATTCGGCTACGGTGTCACCTAAGAAAAGGAAAGCCGA...

Protein

Download Protein FASTA

348 aa · LXL04_001715|LXL04_001715|OH1004|PROTEIN

MNPESSSGGHCPSFMFNSLPPQQQFSSLIANHPISGIVKPDPGWPEFSVYGGQLGNGYLNQNTPGVADQTFTPANSATVSPKKRKADKVPSLQVVSEKDKKIKGCAEEGDSKITHQYSNCDNKSSNSKEASNASSKEKSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQKQVEFLSMKLATVNPELDFNIDSIFTKEMLQSPIQGLGCSSETAADFQLNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001715`
TK1151 ID	TkA01G516360
OH-1004 ID	LXL04_001715
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001715

Location Chr01:31978600-31981071 (+)

Description Similar to BHLH63: Transcription factor bHLH63

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34530`	Transcription factor that binds DNA to G box 5'-CACGTG-3' and, to a lower extent, to E-box 5'-CANNTG-3' in vitro.	Photoexcited CRY2 interacts with CIB1 to regulate transcription and floral initiation in Arabidopsis.2008 · DOI: 10.1126/science.1163927 Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861
`At1g68920`	Transcriptional activator involved in cell elongation.	No verified direct reference in this release
`At1g10120`	Transcriptional activator involved in cell elongation.	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0705500`	Together with BCL1, positive regulator of cell elongation at least partially through increased gibberellic acid (GA) biosynthesis.	Modulation of Rice Leaf Angle and Grain Size by Expressing OsBCL1 and OsBCL2 under the Control of OsBUL1 Promoter.2021 · DOI: 10.3390/ijms22157792
`UniProt: B8AH97`	Together with BCL1, positive regulator of cell elongation at least partially through increased gibberellic acid (GA) biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001715 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010372 positive regulation of gibberellin biosynthetic process Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G10120

ath:AT1G68920

ath:AT4G34530

dosa:Os02g0705500

osa:4330462

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_001715 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_001715 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_001715 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_001715 · OH-1004

Plastid0.011

Rank 5 · LXL04_001715 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH162-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001715	`PF00010.32`	HLH	162	209	1.8e-07	31.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GY61`	Arabidopsis thaliana	Transcription factor bHLH63	45.455%	Swiss-Prot	moderate database homology
`Q9CAA9`	Arabidopsis thaliana	Transcription factor bHLH49	48.908%	Swiss-Prot	moderate database homology
`Q6NKN9`	Arabidopsis thaliana	Transcription factor bHLH74	50.249%	Swiss-Prot	moderate database homology
`Q6Z2G7`	Oryza sativa subsp. japonica	Basic helix-loop-helix protein 79	47.257%	Swiss-Prot	moderate database homology
`B8AH97`	Oryza sativa subsp. indica	Basic helix-loop-helix protein 79	47.257%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card