LXL04_001288 | RubberDandelionOmics

Gene overview

LXL04_001288

Reference: OH-1004 Chr: Chr01 Coordinates: 23445830-23448723 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2568 bp · LXL04_001288|LXL04_001288|OH1004|cDNA

ATGAAACCTCTCTCTTTCATCACCATCTTCCTCTGTTCTTCCTCACGCCGTCTCTTCACCCGTACAATACCACTACCGCTCCTCAATTATGAAGCTGAAAAACTCGTCGGCATCTCCCATTTCTCAACCTCGTCGTTGGACTCCCCAGCCTCCTCTTCCTATCATTCATCTTCAAGACGCAATCATGAGGATGTTAGAAACGTCAGGGTTTCCGTGTGGTGGGACTTCGAGAACTGCTCGATACCTTGTAACGTCAACGT...

CDS

Download CDS FASTA

2568 bp · LXL04_001288|LXL04_001288|OH1004|CDS

ATGAAACCTCTCTCTTTCATCACCATCTTCCTCTGTTCTTCCTCACGCCGTCTCTTCACCCGTACAATACCACTACCGCTCCTCAATTATGAAGCTGAAAAACTCGTCGGCATCTCCCATTTCTCAACCTCGTCGTTGGACTCCCCAGCCTCCTCTTCCTATCATTCATCTTCAAGACGCAATCATGAGGATGTTAGAAACGTCAGGGTTTCCGTGTGGTGGGACTTCGAGAACTGCTCGATACCTTGTAACGTCAACGT...

Protein

Download Protein FASTA

855 aa · LXL04_001288|LXL04_001288|OH1004|PROTEIN

MKPLSFITIFLCSSSRRLFTRTIPLPLLNYEAEKLVGISHFSTSSLDSPASSSYHSSSRRNHEDVRNVRVSVWWDFENCSIPCNVNVYKVTQCITAAVRSVGIKGPIQITAFGDVLQLSRSNQEALSSTGINLTHIPNGGKNSADRSLLVDLMYWVSQNPPPAHLLLISGDRDFASILHRLRMNNYNILLASTDNAPAVLCSAASIMWQWPAIIKGENQNGKHFNQPPDGPYASWYGHYKVQLEDPFAVSNQTSWLQSEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001288`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_001288`
Location	Chr01:23445830-23448723 (-)
Description	Similar to MARF1: Meiosis regulator and mRNA stability factor 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001288` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006302 double-strand break repair Biological Process GO:0007143 female meiotic nuclear division Biological Process GO:0010468 regulation of gene expression Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0003723 RNA binding Molecular Function GO:0004540 RNA nuclease activity Molecular Function GO:1905762 CCR4-NOT complex binding Molecular Function
KEGG gene cross-reference	hsa:9665 mmu:223989 rno:170946 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.375

Rank 1 · LXL04_001288 · OH-1004

Cytoplasm0.300

Rank 2 · LXL04_001288 · OH-1004

Plastid0.205

Rank 3 · LXL04_001288 · OH-1004

Cell membrane0.136

Rank 4 · LXL04_001288 · OH-1004

Endoplasmic reticulum0.082

Rank 5 · LXL04_001288 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01936.25NYN69-205 aa

PF12872.14OST-HTH269-336 aa

PF14418.12OHA548-612 aa

PF12872.14OST-HTH641-700 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001288	`PF01936.25`	NYN	69	205	9.4e-29	101.5
LXL04_001288	`PF12872.14`	OST-HTH	269	336	4.7e-16	59.1
LXL04_001288	`PF14418.12`	OHA	548	612	5.2e-10	39.8
LXL04_001288	`PF12872.14`	OST-HTH	641	700	4.7e-16	59.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card