LXL04_000366 | RubberDandelionOmics

Gene overview

LXL04_000366

Reference: OH-1004 Chr: Chr01 Coordinates: 6699907-6704505 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2814 bp · LXL04_000366|LXL04_000366|OH1004|cDNA

ATGGCTACTGCAAAAGCTCTTGAACCTGCATTTACAGGAGCTGGTTCTAGACCAGGGCTCGAAATATGGAGAATTGAAAATTTTCAGCCCGTACCTTTGCCAAAATCAGATTATGGTAGATTCTATTCCGGTGATTCATACGTCGTCTTGCAGACTTCTCCCGGAAGGGGAGGTAGTAATGCGTACAATATACACTTCTGGTTGGGAAAGGATACTAGCAATGATGAAGCGGGAACAGCAGCAATAAAAACAATTGAGCT...

CDS

Download CDS FASTA

2814 bp · LXL04_000366|LXL04_000366|OH1004|CDS

ATGGCTACTGCAAAAGCTCTTGAACCTGCATTTACAGGAGCTGGTTCTAGACCAGGGCTCGAAATATGGAGAATTGAAAATTTTCAGCCCGTACCTTTGCCAAAATCAGATTATGGTAGATTCTATTCCGGTGATTCATACGTCGTCTTGCAGACTTCTCCCGGAAGGGGAGGTAGTAATGCGTACAATATACACTTCTGGTTGGGAAAGGATACTAGCAATGATGAAGCGGGAACAGCAGCAATAAAAACAATTGAGCT...

Protein

Download Protein FASTA

937 aa · LXL04_000366|LXL04_000366|OH1004|PROTEIN

MATAKALEPAFTGAGSRPGLEIWRIENFQPVPLPKSDYGRFYSGDSYVVLQTSPGRGGSNAYNIHFWLGKDTSNDEAGTAAIKTIELDAILGGRAVQHREIQSHESDKFLAYFKPCIVPLEGGVATGFKKPEEMEFETRLYTCRGKRVVHVRQIQFSRSLLNHDDVFILDSKEKIFQFNGANSNIQERAKALEVIQYLKDTYHEGTCNVAIVDDGKLQAEGDSGEFWVIFGGFAPIGKKVVTEDDIILDRTPGKLYSIGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000366`
TK1151 ID	TkA01G617320
OH-1004 ID	LXL04_000366
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 99.842 / OH-1004 67.236 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000366

Location Chr01:6699907-6704505 (-)

Description Similar to VLN2: Villin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41740`	May act as a Ca²⁺-regulated actin-binding protein.	Arabidopsis VILLIN2 and VILLIN3 are required for the generation of thick actin filament bundles and for directional organ growth.2012 · DOI: 10.1104/pp.111.192385 Arabidopsis VILLIN2 and VILLIN3 act redundantly in sclerenchyma development via bundling of actin filaments.2012 · DOI: 10.1111/j.1365-313x.2012.05044.x Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.2013 · DOI: 10.1105/tpc.113.110940
`At3g57410`	Binds actin and actin bundles independently of Ca²⁺, but severs actin filaments in a calcium-dependent manner.	Arabidopsis VILLIN1 and VILLIN3 have overlapping and distinct activities in actin bundle formation and turnover.2010 · DOI: 10.1105/tpc.110.076240 Arabidopsis VILLIN2 and VILLIN3 are required for the generation of thick actin filament bundles and for directional organ growth.2012 · DOI: 10.1104/pp.111.192385 Arabidopsis VILLIN2 and VILLIN3 act redundantly in sclerenchyma development via bundling of actin filaments.2012 · DOI: 10.1111/j.1365-313x.2012.05044.x
`At4g30160`	Binds actin and actin bundles independently of Ca²⁺, but caps filament barbed ends and severs filaments in a calcium-dependent manner.	Arabidopsis VILLIN4 is involved in root hair growth through regulating actin organization in a Ca2+-dependent manner.2011 · DOI: 10.1111/j.1469-8137.2010.03632.x The universal bundling activity of AtVLN4 in diffusely growing cells.2011 · DOI: 10.4161/psb.6.9.16501
`At5g57320`	Major actin filament stabilizing factor and regulator of actin dynamics.	Arabidopsis VILLIN5, an actin filament bundling and severing protein, is necessary for normal pollen tube growth.2010 · DOI: 10.1105/tpc.110.076257 Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.2013 · DOI: 10.1105/tpc.113.110940

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0356700`	Ca(2+)-regulated actin-binding protein (By similarity).	VLN2 Regulates Plant Architecture by Affecting Microfilament Dynamics and Polar Auxin Transport in Rice.2015 · DOI: 10.1105/tpc.15.00581

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000366 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0007015 actin filament organization Biological Process

GO:0009630 gravitropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051014 actin filament severing Biological Process

GO:0051017 actin filament bundle assembly Biological Process

GO:0051693 actin filament capping Biological Process

GO:0051764 actin crosslink formation Biological Process

GO:0099636 cytoplasmic streaming Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

KEGG gene cross-reference

ath:AT2G41740

ath:AT3G57410

ath:AT4G30160

ath:AT5G57320

dosa:Os03g0356700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.676

Rank 1 · LXL04_000366 · OH-1004

Cell membrane0.245

Rank 2 · LXL04_000366 · OH-1004

Nucleus0.172

Rank 3 · LXL04_000366 · OH-1004

Golgi apparatus0.132

Rank 4 · LXL04_000366 · OH-1004

Endoplasmic reticulum0.083

Rank 5 · LXL04_000366 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00626.28Gelsolin28-110 aa

PF00626.28Gelsolin150-219 aa

PF00626.28Gelsolin270-336 aa

PF25480.2DUF7904398-490 aa

PF00626.28Gelsolin408-482 aa

PF00626.28Gelsolin531-573 aa

PF00626.28Gelsolin655-728 aa

PF02209.25VHP902-937 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000366	`PF00626.28`	Gelsolin	28	110	2.4e-66	220.3
LXL04_000366	`PF00626.28`	Gelsolin	150	219	2.4e-66	220.3
LXL04_000366	`PF00626.28`	Gelsolin	270	336	2.4e-66	220.3
LXL04_000366	`PF25480.2`	DUF7904	398	490	4.8e-16	59.1
LXL04_000366	`PF00626.28`	Gelsolin	408	482	2.4e-66	220.3
LXL04_000366	`PF00626.28`	Gelsolin	531	573	2.4e-66	220.3
LXL04_000366	`PF00626.28`	Gelsolin	655	728	2.4e-66	220.3
LXL04_000366	`PF02209.25`	VHP	902	937	7.4e-15	55.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81644`	Arabidopsis thaliana	Villin-2	57.688%	Swiss-Prot	strong database homology
`O81645`	Arabidopsis thaliana	Villin-3	56.491%	Swiss-Prot	strong database homology
`O65570`	Arabidopsis thaliana	Villin-4	43.644%	Swiss-Prot	moderate database homology
`Q9LVC6`	Arabidopsis thaliana	Villin-5	41.236%	Swiss-Prot	moderate database homology
`Q10L71`	Oryza sativa subsp. japonica	Villin-2	55.321%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card