LXL04_000334 | RubberDandelionOmics

Gene overview

LXL04_000334

Reference: OH-1004 Chr: Chr01 Coordinates: 6246795-6248755 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · LXL04_000334|LXL04_000334|OH1004|cDNA

ATGTCTTCAGTAATTACTCAAGCATCATGCTTCTCTTCAATTCACAACCGATTACACCTCCGTTCTCGATCACACCCTCACCTTCTCCGTTCCAAGGTGTTAATGGTGATGAACAAAGATGGACATGCCATAAAAGCATTTAGTTCAGATAGTGGTACAGCTTTATATCATACAGCTTCTGCATCAAAATCACATAATGATATTGTAACAAAAGCCAATTCAAGTACAGTAGAATATGTGAATGGAGAAGAGATTGATGA...

CDS

Download CDS FASTA

693 bp · LXL04_000334|LXL04_000334|OH1004|CDS

ATGTCTTCAGTAATTACTCAAGCATCATGCTTCTCTTCAATTCACAACCGATTACACCTCCGTTCTCGATCACACCCTCACCTTCTCCGTTCCAAGGTGTTAATGGTGATGAACAAAGATGGACATGCCATAAAAGCATTTAGTTCAGATAGTGGTACAGCTTTATATCATACAGCTTCTGCATCAAAATCACATAATGATATTGTAACAAAAGCCAATTCAAGTACAGTAGAATATGTGAATGGAGAAGAGATTGATGA...

Protein

Download Protein FASTA

230 aa · LXL04_000334|LXL04_000334|OH1004|PROTEIN

MSSVITQASCFSSIHNRLHLRSRSHPHLLRSKVLMVMNKDGHAIKAFSSDSGTALYHTASASKSHNDIVTKANSSTVEYVNGEEIDEPEEQENAVSEPKRSAKIHDFCFGLPYGGIVFSGGIFGFIFSRNPASLISGGLYGGALMALSFLSLKIWRKGHSSLPFILGQAGIASMLLWKNIQTYSLTKKILPTGFHVVLSASMLCFYTYVMLSGGNPPPKKKLKASAASQS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000334`
TK1151 ID	TkA01G618920
OH-1004 ID	LXL04_000334
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000334

Location Chr01:6246795-6248755 (+)

Description Similar to FAX1: Protein FATTY ACID EXPORT 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57280`	Mediates the export of free fatty acid from the plastids.	FAX1, a novel membrane protein mediating plastid fatty acid export.2015 · DOI: 10.1371/journal.pbio.1002053
`At1g50740`	May be involved in free fatty acids export.	No verified direct reference in this release
`At3g20510`	May be involved in free fatty acids export.	No verified direct reference in this release
`At2g38550`	May be involved in free fatty acids export from the plastids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000334 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0019217 regulation of fatty acid metabolic process Biological Process

GO:0055088 lipid homeostasis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0071668 plant-type cell wall assembly Biological Process

GO:1902001 fatty acid transmembrane transport Biological Process

GO:1905885 positive regulation of triglyceride transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G50740

ath:AT2G38550

ath:AT3G20510

ath:AT3G57280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.961

Rank 1 · LXL04_000334 · OH-1004

Mitochondrion0.034

Rank 2 · LXL04_000334 · OH-1004

Nucleus0.027

Rank 3 · LXL04_000334 · OH-1004

Cytoplasm0.017

Rank 4 · LXL04_000334 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_000334 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03647.19Tmemb_14109-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000334	`PF03647.19`	Tmemb_14	109	206	1e-16	62.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V66`	Arabidopsis thaliana	Protein FATTY ACID EXPORT 1, chloroplastic	52.586%	Swiss-Prot	strong database homology
`Q9C6T7`	Arabidopsis thaliana	Protein FATTY ACID EXPORT 5	40.000%	Swiss-Prot	moderate database homology
`Q9LJU6`	Arabidopsis thaliana	Protein FATTY ACID EXPORT 6	37.607%	Swiss-Prot	moderate database homology
`Q9ZVH7`	Arabidopsis thaliana	Protein FATTY ACID EXPORT 3, chloroplastic	31.677%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card