LXL04_000181 | RubberDandelionOmics

Gene overview

LXL04_000181

Reference: OH-1004 Chr: Chr01 Coordinates: 3719870-3722951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1605 bp · LXL04_000181|LXL04_000181|OH1004|cDNA

CAAACCTTCTGTTTCTCGAACAATCAAAAACTCACATGTCCATTCTGCCTTCTTACTATAAATAGCAACTCCTCTTCATCTTTTCCAACCAACCTAGCAACTGTTCAAAGCCATCATCATCACACAGCTTTGACTTTCCTTGTTAAGAAACATCAACTATCTCATCATTCCATTGTGTTACTTTTATCGTCCATGGCTGCCGGAGCTGTAATCCGACCCCTGTTGAACTTGAATGGTTGTGGTGGAAGAACTTTGCCTCC...

CDS

Download CDS FASTA

1476 bp · LXL04_000181|LXL04_000181|OH1004|CDS

TTGACTTTCCTTGTTAAGAAACATCAACTATCTCATCATTCCATTGTGTTACTTTTATCGTCCATGGCTGCCGGAGCTGTAATCCGACCCCTGTTGAACTTGAATGGTTGTGGTGGAAGAACTTTGCCTCCAACGTCGGCATTCTTTGGTGGAGATGTAAAGAAACTCGTTTTTAAACCAAAATCAAAGGTTTCGAGCGGGAAATTCAAGGTTTTTGCAGCTCATGAAGTTGATGAAGATAAGCAGACGAACAAGGACCG...

Protein

Download Protein FASTA

491 aa · LXL04_000181|LXL04_000181|OH1004|PROTEIN

MTFLVKKHQLSHHSIVLLLSSMAAGAVIRPLLNLNGCGGRTLPPTSAFFGGDVKKLVFKPKSKVSSGKFKVFAAHEVDEDKQTNKDRWRGLAFDESDDQQDITRGKGMVDTLFQAPMNDGTHYAVLSSYEYLSAGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIISKGKMCVLFINDLDAGAGRMGGTTQY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000181`
TK1151 ID	TkA01G628910
OH-1004 ID	LXL04_000181
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 88.224 / OH-1004 96.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000181

Location Chr01:3719870-3722951 (+)

Description Similar to RCA1: Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39730`	Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0707000`	Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000181 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT2G39730

dosa:Os11g0707000

vra:106757684

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.588

Rank 1 · LXL04_000181 · OH-1004

Endoplasmic reticulum0.132

Rank 2 · LXL04_000181 · OH-1004

Nucleus0.091

Rank 3 · LXL04_000181 · OH-1004

Golgi apparatus0.086

Rank 4 · LXL04_000181 · OH-1004

Cytoplasm0.075

Rank 5 · LXL04_000181 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004.36AAA180-323 aa

PF21228.4RuBisCO_activase_AAA_helical326-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000181	`PF00004.36`	AAA	180	323	5.2e-18	66.5
LXL04_000181	`PF21228.4`	RuBisCO_activase_AAA_helical	326	421	2.5e-41	140.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P10896`	Arabidopsis thaliana	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	80.384%	Swiss-Prot	strong database homology
`P93431`	Oryza sativa subsp. japonica	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	81.278%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card