LXL04_000177 | RubberDandelionOmics

Gene overview

LXL04_000177

Reference: OH-1004 Chr: Chr01 Coordinates: 3629131-3630655 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · LXL04_000177|LXL04_000177|OH1004|cDNA

ATGGCGATTCTTCAGATCCTTCCCTCACCTCCGTCTTTCCGTTATACGGCTTGCTTCCGTTCCTTCCCCAGAATTCTCATACCCCGAGCATCCATTAATGGCGACCACACTGTCTCGACCTCGCAGCAACCCACTCGCCGTGGCCGGAAAAAATCAACCTCTACCACAACAATACCCTCCACTAAAAGTTCCAGTCGCACGAAGAAATCAGAACCAGAAGTAAACAGAATTGAAAATGCAGAAAATTTAGAGGATTTTGA...

CDS

Download CDS FASTA

1410 bp · LXL04_000177|LXL04_000177|OH1004|CDS

ATGGCGATTCTTCAGATCCTTCCCTCACCTCCGTCTTTCCGTTATACGGCTTGCTTCCGTTCCTTCCCCAGAATTCTCATACCCCGAGCATCCATTAATGGCGACCACACTGTCTCGACCTCGCAGCAACCCACTCGCCGTGGCCGGAAAAAATCAACCTCTACCACAACAATACCCTCCACTAAAAGTTCCAGTCGCACGAAGAAATCAGAACCAGAAGTAAACAGAATTGAAAATGCAGAAAATTTAGAGGATTTTGA...

Protein

Download Protein FASTA

469 aa · LXL04_000177|LXL04_000177|OH1004|PROTEIN

MAILQILPSPPSFRYTACFRSFPRILIPRASINGDHTVSTSQQPTRRGRKKSTSTTTIPSTKSSSRTKKSEPEVNRIENAENLEDFEDGIDFPYEDPPLICCFGAAQKEFVPTVRVSDQQMDPDMYSEWKMLQWDPPEFARAPGGPPSNVAIAHVRLGGRAAFMGKVGDDDLGQELVLMMNKEKVQTRSVKIDPKEKTGRSYMKITFDKKGKMKAEKVKDAAEDSFMSSELNLSVLKEARIFHFNSEVLLTDSMQSALFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000177`
TK1151 ID	TkA01G629240
OH-1004 ID	LXL04_000177
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 97.943 / OH-1004 81.237 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000177

Location Chr01:3629131-3630655 (-)

Description Similar to FLN1: Fructokinase-like 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54090`	Required for proper chloroplast development, most likely through regulating plastid-encoded polymerase (PEP) dependent chloroplast transcription.	Plastidial thioredoxin z interacts with two fructokinase-like proteins in a thiol-dependent manner: evidence for an essential role in chloroplast development in Arabidopsis and Nicotiana benthamiana.2010 · DOI: 10.1105/tpc.109.071001 The plastid-localized pfkB-type carbohydrate kinases FRUCTOKINASE-LIKE 1 and 2 are essential for growth and development of Arabidopsis thaliana.2012 · DOI: 10.1186/1471-2229-12-102
`At1g69200`	Required for proper chloroplast development, most likely through regulating plastid-encoded polymerase (PEP) dependent chloroplast transcription.	Plastidial thioredoxin z interacts with two fructokinase-like proteins in a thiol-dependent manner: evidence for an essential role in chloroplast development in Arabidopsis and Nicotiana benthamiana.2010 · DOI: 10.1105/tpc.109.071001 The plastid-localized pfkB-type carbohydrate kinases FRUCTOKINASE-LIKE 1 and 2 are essential for growth and development of Arabidopsis thaliana.2012 · DOI: 10.1186/1471-2229-12-102 The reduced plastid-encoded polymerase-dependent plastid gene expression leads to the delayed greening of the Arabidopsis fln2 mutant.2013 · DOI: 10.1371/journal.pone.0073092
`At1g66430`	May play an important role in maintaining the flux of carbon towards starch formation.	No verified direct reference in this release
`At3g59480`	May play an important role in maintaining the flux of carbon towards starch formation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000177 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006000 fructose metabolic process Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009662 etioplast organization Biological Process

GO:0016051 carbohydrate biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0042793 plastid transcription Biological Process

GO:0000427 plastid-encoded plastid RNA polymerase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G66430

ath:AT1G69200

ath:AT3G54090

ath:AT3G59480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.942

Rank 1 · LXL04_000177 · OH-1004

Mitochondrion0.062

Rank 2 · LXL04_000177 · OH-1004

Nucleus0.033

Rank 3 · LXL04_000177 · OH-1004

Cytoplasm0.028

Rank 4 · LXL04_000177 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_000177 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00294.30PfkB121-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000177	`PF00294.30`	PfkB	121	327	2.5e-32	113.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M394`	Arabidopsis thaliana	Fructokinase-like 1, chloroplastic	70.732%	Swiss-Prot	strong database homology
`F4I0K2`	Arabidopsis thaliana	Fructokinase-like 2, chloroplastic	46.556%	Swiss-Prot	moderate database homology
`Q9C524`	Arabidopsis thaliana	Probable fructokinase-6, chloroplastic	31.527%	Swiss-Prot	moderate database homology
`Q9M1B9`	Arabidopsis thaliana	Probable fructokinase-4	33.880%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card