LXL04_000158 | RubberDandelionOmics

Gene overview

LXL04_000158

Reference: OH-1004 Chr: Chr01 Coordinates: 3293977-3296741 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_000158|LXL04_000158|OH1004|cDNA

ATGTCGAATCCGGGAGGTCAAGGCGAGTCCAAACAACCTGCTCCTAAGCAAGAATTGCAACCACACCCAGTAATGGAGCAACTTGGTGGTGTTCAATATTGCGTTAATAGTCCACCGCCATGGAAAGAAGCGGTGTTATTAGGGTTCCAACATTATGTTTTATCACTTGGTAACACTGTGTTGATTTCAACGATGACGGTTTCTCAAATGGGCGGTGATAATGGTGAGAAAGCCAGGGTGATTCAGACGCTGCTTTTTCT...

CDS

Download CDS FASTA

1575 bp · LXL04_000158|LXL04_000158|OH1004|CDS

ATGTCGAATCCGGGAGGTCAAGGCGAGTCCAAACAACCTGCTCCTAAGCAAGAATTGCAACCACACCCAGTAATGGAGCAACTTGGTGGTGTTCAATATTGCGTTAATAGTCCACCGCCATGGAAAGAAGCGGTGTTATTAGGGTTCCAACATTATGTTTTATCACTTGGTAACACTGTGTTGATTTCAACGATGACGGTTTCTCAAATGGGCGGTGATAATGGTGAGAAAGCCAGGGTGATTCAGACGCTGCTTTTTCT...

Protein

Download Protein FASTA

524 aa · LXL04_000158|LXL04_000158|OH1004|PROTEIN

MSNPGGQGESKQPAPKQELQPHPVMEQLGGVQYCVNSPPPWKEAVLLGFQHYVLSLGNTVLISTMTVSQMGGDNGEKARVIQTLLFLSGINTLTQTMFGTRLPSVVGGSHAFLVPVISIVHAKRYHMYQEPHQRFAQTMRGIQGALVVASAFQMLLGFLGLWRNIVKYLSPLSVVPLVTFTGLGLYHLAFPMLEKCVAIGLAELALIYLPPYITSKRPICDRFVILFSVSIAWTCAVILTWSGAYTKSTTNTLNTCRTNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000158`
TK1151 ID	TkA01G630770
OH-1004 ID	LXL04_000158
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 95.420 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000158

Location Chr01:3293977-3296741 (-)

Description Similar to NAT10: Putative nucleobase-ascorbate transporter 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65550`	Putative nucleobase-ascorbate transporter 10.	No verified direct reference in this release
`At1g60030`	Nucleobase-ascorbate transporter 7.	No verified direct reference in this release
`At5g62890`	Nucleobase-ascorbate transporter 6.	No verified direct reference in this release
`At1g10540`	Nucleobase-ascorbate transporter 8.	No verified direct reference in this release
`At1g49960`	Nucleobase-ascorbate transporter 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000158 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G10540

ath:AT1G49960

ath:AT1G60030

ath:AT1G65550

ath:AT5G62890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.842

Rank 1 · LXL04_000158 · OH-1004

Cytoplasm0.113

Rank 2 · LXL04_000158 · OH-1004

Endoplasmic reticulum0.055

Rank 3 · LXL04_000158 · OH-1004

Lysosome / Vacuole0.047

Rank 4 · LXL04_000158 · OH-1004

Mitochondrion0.035

Rank 5 · LXL04_000158 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00860.27Xan_ur_permease43-439 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000158	`PF00860.27`	Xan_ur_permease	43	439	1.1e-54	186.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04472`	Arabidopsis thaliana	Putative nucleobase-ascorbate transporter 10	55.660%	Swiss-Prot	strong database homology
`Q0WPE9`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 7	54.857%	Swiss-Prot	strong database homology
`Q27GI3`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 6	54.753%	Swiss-Prot	strong database homology
`Q8VZQ5`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 8	52.996%	Swiss-Prot	strong database homology
`P93039`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 4	52.591%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card