Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1824 bp · LXL04_000073|LXL04_000073|OH1004|cDNA
ATGTACAAATCTCGATGCAATAGTTCCATCCATGGAGCAAAATCGCAACTTGATTACGCTGAAATGGATCCATCAGGTCGATATGGACGTTTCAAGGAAATTTTGGGGAAAGGAGCAACGAAATCGGTTTACAAGGCATTCGATGAGGTTTTAGCAATGGAAGTGGCTTGGAACCAGGTGAAACTCAACGACATTTTCCGATCACCAGAAGAACTTCAACGCCTATATTCAGAAGTCCATCTCCTCAAAAACCTAAATCA...
1824 bp · LXL04_000073|LXL04_000073|OH1004|CDS
ATGTACAAATCTCGATGCAATAGTTCCATCCATGGAGCAAAATCGCAACTTGATTACGCTGAAATGGATCCATCAGGTCGATATGGACGTTTCAAGGAAATTTTGGGGAAAGGAGCAACGAAATCGGTTTACAAGGCATTCGATGAGGTTTTAGCAATGGAAGTGGCTTGGAACCAGGTGAAACTCAACGACATTTTCCGATCACCAGAAGAACTTCAACGCCTATATTCAGAAGTCCATCTCCTCAAAAACCTAAATCA...
Protein
Download Protein FASTA607 aa · LXL04_000073|LXL04_000073|OH1004|PROTEIN
MYKSRCNSSIHGAKSQLDYAEMDPSGRYGRFKEILGKGATKSVYKAFDEVLAMEVAWNQVKLNDIFRSPEELQRLYSEVHLLKNLNHNSIMRFHTSWIDVDRRTFNFITEMFTAGSLREYRQKYKRVHILAIKDWARQILQGLTYLHSHNPPVIHRDLKCDNIFINGHLGQVKIGDLGLAATLCESQHAHSVIGNDSRLFSITYFFRTPEFMAPEMYEEDYNELVDIYSFGMCMLEMLTSEYPYTECSNPAQIYKKVTSG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000073 |
|---|---|
| TK1151 ID | TkA01G636920 |
| OH-1004 ID | LXL04_000073 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 95.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 50.906Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000073 | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:1644874-1648120 (-) | |||||||||||||||||||||
| Description | Similar to WNK4: Probable serine/threonine-protein kinase WNK4 | |||||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| |||||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0048573 photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0004672 protein kinase activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function | |||||||||||||||||||||
| KEGG gene cross-reference | ath:AT3G22420 ath:AT5G28080 ath:AT5G58350 dosa:Os07g0572800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07714.24PK_Tyr_Ser-Thr31-295 aaPF00069.32Pkinase32-300 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000073 | PF07714.24 | PK_Tyr_Ser-Thr | 31 | 295 | 3.7e-30 | 105.8 |
| LXL04_000073 | PF00069.32 | Pkinase | 32 | 300 | 3.6e-44 | 151.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9LVL5 | Arabidopsis thaliana | Probable serine/threonine-protein kinase WNK4 | 48.756% | Swiss-Prot | moderate database homology |
Q8S8Y9 | Arabidopsis thaliana | Serine/threonine-protein kinase WNK2 | 53.333% | Swiss-Prot | moderate database homology |
Q2V338 | Arabidopsis thaliana | Probable serine/threonine-protein kinase WNK9 | 51.016% | Swiss-Prot | moderate database homology |
Q0D598 | Oryza sativa subsp. japonica | Probable serine/threonine-protein kinase WNK1 | 52.703% | Swiss-Prot | moderate database homology |
A2YMV6 | Oryza sativa subsp. indica | Probable serine/threonine-protein kinase WNK1 | 52.703% | Swiss-Prot | moderate database homology |